4OGA: Insulin

Insulin in complex with Site 1 of the human insulin receptor. Determined by X-ray diffraction at 3.5 Å resolution. Released 27 Aug 2014.

Method: X-ray diffraction
Resolution: 3.5 Å
Organisms: Homo sapiens, Mus musculus
Chains: 6
Atoms: 4,693
Mol. weight: 71.69 kDa
Ligands: NAG
Released: 27 Aug 2014

Explore 4OGA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4OGA contains 22 α-helices and 56 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
α-helix	2-6	5
β-strand	20	1	1

Chain B: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	10-19	10
α-helix	20-22	3
β-strand	24	1	1

Chain C: 3 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	2
β-strand	11-12	2	3
β-strand	18-25	8	2
β-strand	33-39	7	4
β-strand	46-51	6	4
β-strand	57-59	3	4
α-helix	61-63	3
β-strand	67-72	6	2
α-helix	73-75	3
β-strand	77-82	6	2
α-helix	87-89	3
β-strand	91-98	8	4
β-strand	108	1	4
β-strand	112-114	3	4
β-strand	115-116	2	3

Chain D: 3 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	5
β-strand	10-14	5	6
β-strand	18-25	8	5
β-strand	30-31	2	7
α-helix	32-34	3
β-strand	36-37	2	7
β-strand	39-44	6	6
β-strand	51-55	5	6
β-strand	59-60	2	6
α-helix	61	1
β-strand	68-73	6	5
β-strand	76-82	7	5
α-helix	86-88	3
β-strand	90-96	7	6
β-strand	102-103	2	6
β-strand	107-112	6	6

Chain E: 12 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	7-14	8	8
α-helix	18-23	6
β-strand	28-38	11	8
α-helix	43-46	4
β-strand	56-57	2	8
β-strand	61-66	6	8
β-strand	81-82	2	8
β-strand	88	1	8
β-strand	91-96	6	8
β-strand	111-112	2	8
β-strand	116-122	7	8
α-helix	133-135	3
β-strand	144-148	5	8
α-helix	149-152	4
β-strand	172-173	2	9
β-strand	178-179	2	9
β-strand	182-184	3	10
β-strand	187-188	2	10
α-helix	189-190	2
α-helix	194-196	3
β-strand	201	1	11
α-helix	206	1
β-strand	207	1	11
α-helix	208-209	2
β-strand	212	1	12
β-strand	216	1	13
β-strand	225	1	13
β-strand	228	1	12
β-strand	231-233	3	14
β-strand	236-238	3	14
α-helix	241-242	2
β-strand	245-248	4	14
β-strand	252-255	4	14
α-helix	256-263	8
β-strand	278-280	3	14
β-strand	283-285	3	14
α-helix	288-289	2
β-strand	292-294	3	15
β-strand	300	1	14
β-strand	301-303	3	15
α-helix	308-309	2

Chain F: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	706-713	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Insulin A chain	A	protein	21	Homo sapiens	P01308 (AlphaFold model)
Insulin B chain	B	protein	30	Homo sapiens	P01308 (AlphaFold model)
monoclonal antibody fab 83-7 fragment - heavy chain	C	protein	118	Mus musculus
monoclonal antibody fab 83-7 fragment - light chain	D	protein	114	Mus musculus
Insulin receptor domains L1-CR	E	protein	317	Homo sapiens	P06213 (AlphaFold model)
Insulin receptor alpha-CT peptide	F	protein	16	Homo sapiens	P06213 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4OGA_1 Insulin A chain (chains A)
GIVEQCCTSICSLYQLENYCN

Sequence of entity 2 (B), FASTA

>4OGA_2 Insulin B chain (chains B)
FVNQHLCGSHLVEALYLVCGERGFFYTPKT

Sequence of entity 3 (C), FASTA

>4OGA_3 monoclonal antibody fab 83-7 fragment - heavy chain (chains C)
QVQLKESGPGLVAPSQSLSITCTVSGFPLTAYGVNWVRQPPGKGLEWLGMIWGDGNTDYN
SALKSRLSISKDNSKSQVFLKMNSLQTDDTARYYCARDPYGSKPMDYWGQGTSVTVSS

Sequence of entity 4 (D), FASTA

>4OGA_4 monoclonal antibody fab 83-7 fragment - light chain (chains D)
DIVMSQSPSSLVVSVGEKVTMSCKSSQSLLYSSNQKNFLAWYQQKPGQSPKLLIYWASTR
ESGVPDRFTGSGSGTDFTLTISSVKAEDLAVYYCQQYFRYRTFGGGTKLEIKRA

Sequence of entity 5 (E), FASTA

>4OGA_5 Insulin receptor domains L1-CR (chains E)
HLYPGEVCPGMDIRNNLTRLHELENCSVIEGHLQILLMFKTRPEDFRDLSFPKLIMITDY
LLLFRVYGLESLKDLFPNLTVIRGSRLFFNYALVIFEMVHLKELGLYNLMNITRGSVRIE
KNNELCYLATIDWSRILDSVEDNHIVLNKDDNEECGDICPGTAKGKTNCPATVINGQFVE
RCWTHSHCQKVCPTICKSHGCTAEGLCCHSECLGNCSQPDDPTKCVACRNFYLDGRCVET
CPPPYYHFQDWRCVNFSFCQDLHHKCKNSRRQGCHQYVIHNNKCIPECPSGYTMNSSNLL
CTPCLGPCPKSSSLVPR

Sequence of entity 6 (F), FASTA

>4OGA_6 Insulin receptor alpha-CT peptide (chains F)
TFEDYLHNVVFVPRPS

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	3

Primary citation

Protective hinge in insulin opens to enable its receptor engagement. Menting, J.G., Yang, Y., Chan, S.J. et al. Proc Natl Acad Sci U S A (2014) 111:E3395-E3404. DOI 10.1073/pnas.1412897111 · PubMed

Other PDB entries of the same protein (UniProt P01308 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3W7Y 0.92 Å, 0.92A structure of 2Zn human insulin at 100K
5E7W 0.95 Å, X-ray Structure of Human Recombinant 2Zn insulin at 0.92 Angstrom
5HQI 0.97 Å, Insulin with proline analog HzP at position B28 in the T2 state
1MSO 1.0 Å, T6 Human Insulin at 1.0 A Resolution
3HYD 1.0 Å, LVEALYL peptide derived from human insulin chain B, residues 11-17
6VER 1.05 Å, Human insulin analog: [GluB10,TyrB20]-DOI
4FKA 1.08 Å, High resolution structure of the manganese derivative of insulin
3TT8 1.12 Å, Crystal Structure Analysis of Cu Human Insulin Derivative
3W7Z 1.15 Å, 1.15A structure of human 2Zn insulin at 293K
8OKY 1.17 Å, Crystal structure of D-ProB26-DTriA analogue of human insulin
5USP 1.17 Å, Insulin with proline analog Pip at position B28 in the T2 state
5UOZ 1.17 Å, Insulin with proline analog FyP at position B28 in the T2 state

Browse more

4OGA is part of these collections:

Insulin and hormones

About this viewer

MolViewer shows 4OGA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.