4ON9: DECH box helicase domain

DECH box helicase domain. Determined by X-ray diffraction at 2.71 Å resolution. Released 2 Jul 2014.

Method

X-ray diffraction

Resolution

2.71 Å

Organism

Homo sapiens

Chains

2

Atoms

8,183

Mol. weight

132.63 kDa

Released

2 Jul 2014

Explore 4ON9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4ON9 contains 49 α-helices and 29 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 25 helices, 15 β-strands

Molecules and chains

>4ON9_1 Probable ATP-dependent RNA helicase DDX58 (chains A, B)
MGSSHHHHHHSQDPNSSEVSDTNLYSPFKPRNYQLELALPAMKGKNTIICAPTGCGKTFV
SLLICEHHLKKFPQGQKGKVVFFANQIPVYEQQKSVFSKYFERHGYRVTGISGATAENVP
VEQIVENNDIIILTPQILVNNLKKGTIPSLSIFTLMIFDECHNTSKQHPYNMIMFNYLDQ
KLGGSSGPLPQVIGLTASVGVGDAKNTDEALDYICKLCASLDASVIATVKHNLEELEQVV
YKPQKFFRKVESRISDKFKYIIAQLMRDTESLAKRICKDLENLSQIQNREFGTQKYEQWI
VTVQKACMVFQMPDKDEESRICKALFLYTSHLRKYNDALIISEHARMKDALDYLKDFFSN
VRAAGFDEIEQDLTQRFEEKLQELESVSRDPSNENPKLEDLCFILQEEYHLNPETITILF
VKTRALVDALKNWIEGNPKLSFLKPGILTGRGKTNQNTGMTLPAQKCILDAFKASGDHNI
LIATSVADEGIDIAQCNLVILYEYVGNVIKMIQTRGRGRARGSKCFLLTSNAGVIEKEQI
NMYKEKMMNDSILRLQTWDEAVFREKILHIQTHEKFIRDS

Primary citation

Crystal and solution structure of the human RIG-I SF2 domain. Deimling, T., Cui, S., Lammens, K. et al. Acta Crystallogr Sect F Struct Biol Cryst Commun (2014) 70:1027-1031. DOI 10.1107/S2053230X14012230 · PubMed

Related structures

Other PDB entries of the same protein (UniProt O95786 (AlphaFold model), which also has an AlphaFold model), best resolution first:

• 7BAH 1.89 Å, Structure of RIG-I CTD bound to OH-RNA
• 7MK1 1.9 Å, Structure of a protein-modified aptamer complex
• 3LRR 2.15 Å, Crystal structure of human RIG-I CTD bound to a 12 bp AU rich 5' ppp dsRNA
• 3OG8 2.4 Å, Crystal structure of human RIG-I CTD bound to a 14-bp blunt-ended dsRNA
• 9KU4 2.4 Å, Cryo-EM structure of E373A mutant RIG-I with 5'p-RNA
• 2YKG 2.5 Å, Structural insights into RNA recognition by RIG-I
• 3ZD7 2.5 Å, Snapshot 3 of RIG-I scanning on RNA duplex
• 3NCU 2.55 Å, Structural and functional insights into pattern recognition by the innate immune…
• 4BPB 2.58 Å, Structural insights into RNA recognition by rig-I
• 3LRN 2.6 Å, Crystal structure of human RIG-I CTD bound to a 14 bp GC 5' ppp dsRNA
• 9KTW 2.6 Å, Cryo-EM structure of wild type RIG-I with 5'p-RNA
• 5F9F 2.6 Å, Crystal structure of RIG-I helicase-RD in complex with 24-mer blunt-end hairpin RNA

Browse structure collections

About this viewer

MolViewer shows 4ON9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.