4ONI: Human Orphan Receptor LRH1

Structure of Human Orphan Receptor LRH1 bound to two bacterial phospholipids. Determined by X-ray diffraction at 1.8 Å resolution. Released 11 Feb 2015.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 4
Atoms: 4,780
Mol. weight: 64.22 kDa
Ligands: EPH, P6L
Released: 11 Feb 2015

Explore 4ONI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4ONI contains 30 α-helices and 6 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	301-302	2	1
α-helix	303-309	7
α-helix	315-331	17
α-helix	338-340	3
α-helix	341-362	22
α-helix	366-368	3
α-helix	371-397	27
β-strand	402-404	3	2
β-strand	410-412	3	2
α-helix	413-419	7
α-helix	422-441	20
α-helix	445-456	12
α-helix	467-488	22
α-helix	495-500	6
α-helix	503-522	20
α-helix	531-538	8

Chain B: 14 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	303-309	7
α-helix	312-314	3
α-helix	315-331	17
α-helix	338-340	3
α-helix	341-361	21
α-helix	364-367	4
α-helix	371-397	27
β-strand	402-404	3	3
β-strand	410-412	3	3
α-helix	413-419	7
α-helix	422-441	20
α-helix	445-456	12
α-helix	467-488	22
α-helix	495-500	6
α-helix	502-522	21
α-helix	531-536	6
β-strand	539-540	2	1

Chain C: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	14-16	3
α-helix	19-26	8

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	19-26	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nuclear receptor subfamily 5 group A member 2	A, B	protein	253	Homo sapiens	O00482 (AlphaFold model)
Nuclear receptor subfamily 0 group B member 2	C, D	protein	19	Homo sapiens	Q15466 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4ONI_1 Nuclear receptor subfamily 5 group A member 2 (chains A, B)
SNDSYQTSSPASIPHLILELLKCEPDEPQVQAKIMAYLQQEQANRSKHEKLSTFGLMCKM
ADQTLFSIVEWARSSIFFRELKVDDQMKLLQNCWSELLILDHIYRQVVHGKEGSIFLVTG
QQVDYSIIASQAGATLNNLMSHAQELVAKLRSLQFDQREFVCLKFLVLFSLDVKNLENFQ
LVEGVQEQVNAALLDYTMCNYPQQTEKFGQLLLRLPEIRAISMQAEEYLYYKHLNGDVPY
NNLLIEMLHAKRA

Sequence of entity 2 (C, D), FASTA

>4ONI_2 Nuclear receptor subfamily 0 group B member 2 (chains C, D)
QGAASRPAILYALLSSSLK

Ligands and cofactors

ID	Name	Formula	Copies
EPH	L-alpha-phosphatidyl-beta-oleoyl-gamma-palmitoyl-phosphatidylethanolamine	C39 H68 N O8 P	1
P6L	(2S)-3-{[{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-2-[(6E)-hexade…	C40 H75 O10 P	1

Water and common crystallization additives (PG4, GOL) are not listed.

Primary citation

Human nuclear receptor LRH1 bound to phosopholipids and SHP peptide. Gorman, M.A., Parker, M.W., Kusumo, S. To be published.

Other PDB entries of the same protein (UniProt O00482 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6VC2 1.7 Å, LRH-1 bound to SS-RJW100 and a fragment of the Tif2 Coactivator
3PLZ 1.75 Å, Human LRH1 LBD bound to GR470
4PLD 1.75 Å, Human Nuclear Receptor Liver Receptor Homologue-1, LRH-1, in its apo State Bound to a…
4PLE 1.75 Å, Human Nuclear Receptor Liver Receptor Homologue-1, LRH-1, Bound to an E. Coli…
5L11 1.85 Å, Human Liver Receptor Homologue-1 (LRH-1) Bound to RJW100 and a Fragment of TIF-2
4RWV 1.86 Å, Crystal structure of PIP3 bound human nuclear receptor LRH-1 (Liver Receptor Homolog 1,…
1YUC 1.9 Å, Human Nuclear Receptor Liver Receptor Homologue-1, LRH-1, Bound to Phospholipid and a…
4DOR 1.9 Å, Human Nuclear Receptor Liver Receptor Homologue-1, LRH-1, in its apo State Bound to a…
5SYZ 1.93 Å, Human Liver Receptor Homologue-1 (LRH-1) Bound to a RJW100 stereoisomer and a Fragment…
5UNJ 1.96 Å, Structure of Human Liver Receptor Homolog 1 in complex with PGC1a and RJW100
4DOS 2.0 Å, Human Nuclear Receptor Liver Receptor Homologue-1, LRH-1, Bound to DLPC and a Fragment…
6OQX 2.0 Å, Human Liver Receptor Homolog-1 bound to the agonist 5N and a fragment of the Tif2…

Browse structure collections

About this viewer

MolViewer shows 4ONI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.