4ORA: Human calcineurin mutant

Crystal structure of a human calcineurin mutant. Determined by X-ray diffraction at 2.75 Å resolution. Released 20 May 2015.

Method: X-ray diffraction
Resolution: 2.75 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,614
Mol. weight: 80.9 kDa
Ligands: CA, FE, ZN
Released: 20 May 2015

Explore 4ORA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4ORA contains 34 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 22 helices, 20 β-strands

Element	Residues	Length	Sheet
α-helix	16-19	4
α-helix	21-23	3
α-helix	31-34	4
α-helix	37	1
β-strand	38	1	1
α-helix	39	1
α-helix	40-43	4
β-strand	44	1	2
β-strand	50	1	2
α-helix	52-60	9
β-strand	65	1	1
α-helix	67-82	16
β-strand	87-90	4	3
β-strand	94-97	4	4
α-helix	104-114	11
β-strand	122-124	3	4
α-helix	135-148	14
β-strand	153-155	3	4
α-helix	156-158	3
α-helix	163-168	6
α-helix	171-178	8
α-helix	181-193	13
β-strand	197-200	4	3
β-strand	204-207	4	3
α-helix	218-222	5
α-helix	235-241	7
β-strand	243-244	2	5
β-strand	257-259	3	5
β-strand	267-269	3	5
α-helix	271-280	10
β-strand	285-288	4	3
β-strand	297-299	3	3
β-strand	302	1	6
β-strand	309	1	6
β-strand	311-314	4	3
α-helix	320-322	3
β-strand	328-334	7	4
β-strand	337-343	7	4
α-helix	353-355	3
α-helix	358-378	21
α-helix	479-484	6
α-helix	487-490	4

Chain B: 12 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	6-8	3
α-helix	16-29	14
α-helix	39-43	5
α-helix	46-48	3
α-helix	54-61	8
α-helix	71-79	9
α-helix	87-98	12
β-strand	106	1	7
α-helix	108-119	12
α-helix	125-139	15
β-strand	147	1	7
α-helix	149-156	8
α-helix	157-159	3
α-helix	161-163	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform	A	protein	544	Homo sapiens	P16298 (AlphaFold model)
Calcineurin subunit B type 1	B	protein	170	Homo sapiens	P63098 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4ORA_1 Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform (chains A)
MGSSHHHHHHSSGLVPRGSHMAAPEPARAAPPPPPPPPPPPGADRVVKAVPFPPTHRLTS
EEVFDLDGIPRVDVLKNHLVKEGRVDEEIALRIINEGAAILRREKTMIEVEAPITVCGDI
HGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWVLKILYPSTLFLLRGNH
ECRHLTEYFTFKQECKIKYSERVYEACMEAFDSLPLAALLNQQFLCVHGGLSPEIHTLDD
IRRLDRFKEPPAFGPMCDLLWSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQN
NNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNI
RQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSDDELMTEGEDQFDGSAAA
RKEIIRNKIRAIGKMARYLSVLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEA
IEAEKAIRGFSPPHRICSFEEAKGLDRINERMPPRKDAVQQDGFNSLNTAHATENHGTGN
HTAQ

Sequence of entity 2 (B), FASTA

>4ORA_2 Calcineurin subunit B type 1 (chains B)
MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID
IFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMV
GNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	4
FE	FE (III) ion	Fe	1
ZN	Zinc ion	Zn	1

Primary citation

Cooperative autoinhibition and multi-level activation mechanisms of calcineurin. Li, S.J., Ma, L., Wang, J. et al. To be published.

Other PDB entries of the same protein (UniProt P16298 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4OR9 2.23 Å, Crystal structure of human calcineurin
4ORC 2.7 Å, Crystal structure of mammalian calcineurin

Browse structure collections

About this viewer

MolViewer shows 4ORA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.