4OWI: Peptide structure
peptide structure. Determined by X-ray diffraction at 1.2 Å resolution. Released 21 May 2014.
- Method
- X-ray diffraction
- Resolution
- 1.2 Å
- Organism
- synthetic construct
- Chains
- 2
- Atoms
- 674
- Mol. weight
- 7.86 kDa
- Released
- 21 May 2014
Explore 4OWI in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
4OWI contains 2 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 0-27 | 28 | |
Chain B: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 0-29 | 30 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| p53LZ2 | A, B | protein | 33 | synthetic construct | P03069 (AlphaFold model) |
Sequence of entity 1 (A, B), FASTA
>4OWI_1 p53LZ2 (chains A, B)
GSMRMKQLEDKVGELLFSNYWLELEVARLKKLV
Primary citation
Protein grafting of p53TAD onto a leucine zipper scaffold generates a potent HDM dual inhibitor. Lee, J.H., Kang, E., Lee, J. et al. Nat Commun (2014) 5:3814-3814. DOI 10.1038/ncomms4814 · PubMed
Other PDB entries of the same protein (UniProt P03069 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 3AZD 0.98 Å, Crystal structure of tropomyosin N-terminal fragment at 0.98A resolution
- 2WQ1 1.08 Å, GCN4 leucine zipper mutant with three IxxNTxx motifs coordinating bromide
- 2WQ0 1.12 Å, GCN4 leucine zipper mutant with three IxxNTxx motifs coordinating chloride
- 2WQ3 1.22 Å, GCN4 leucine zipper mutant with three IxxNTxx motifs coordinating chloride and nitrate
- 2HY6 1.25 Å, A seven-helix coiled coil
- 2WPZ 1.25 Å, GCN4 leucine zipper mutant with two VxxNxxx motifs coordinating chloride
- 6PSA 1.3 Å, PIE12 D-peptide against HIV entry (in complex with IQN17 Q577R resistance mutant)
- 2IPZ 1.35 Å, A Parallel Coiled-Coil Tetramer with Offset Helices
- 2YNY 1.35 Å, Salmonella enterica SadA 255-302 fused to GCN4 adaptors (SadAK1)
- 5APU 1.35 Å, Sequence IANKEDKAD inserted between GCN4 adaptors - Structure A9b black
- 2WQ2 1.36 Å, GCN4 leucine zipper mutant with three IxxNTxx motifs coordinating iodide
- 5APS 1.37 Å, Sequence IENKKAD inserted between GCN4 adaptors - Structure A7
Browse structure collections
About this viewer
MolViewer shows 4OWI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.