4P0C: NHERF2 PDZ1 Domain

Crystal Structure of NHERF2 PDZ1 Domain in Complex with LPA2. Determined by X-ray diffraction at 1.34 Å resolution. Released 21 May 2014.

Method: X-ray diffraction
Resolution: 1.34 Å
Organism: Homo sapiens
Chains: 1
Atoms: 835
Mol. weight: 9.93 kDa
Ligands: SCN
Released: 21 May 2014

Explore 4P0C in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4P0C contains 3 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	10-15	6	1
β-strand	17	1	2
β-strand	20	1	2
β-strand	23-27	5	1
β-strand	34-39	6	1
α-helix	44-47	4
α-helix	54	1
β-strand	55-59	5	1
β-strand	62-63	2	1
α-helix	69-78	10
β-strand	82-88	7	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Na(+)/H(+) exchange regulatory cofactor NHE-RF2/Lysophosphatidic acid receptor 2 chimeric protein	A	protein	88	Homo sapiens	Q15599 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4P0C_1 Na(+)/H(+) exchange regulatory cofactor NHE-RF2/Lysophosphatidic acid receptor 2 chimeric protein (chains A)
MPRLCRLVRGEQGYGFHLHGEKGRRGQFIRRVEPGSPAEAAALRAGDRLVEVNGVNVEGE
THHQVVQRIKAVEGQTRLLVVDQMDSTL

Ligands and cofactors

ID	Name	Formula	Copies
SCN	Thiocyanate ion	C N S	1

Water and common crystallization additives (CL) are not listed.

Primary citation

Structural insights into PDZ-mediated interaction of NHERF2 and LPA2, a cellular event implicated in CFTR channel regulation. Holcomb, J., Jiang, Y., Lu, G. et al. Biochem Biophys Res Commun (2014) 446:399-403. DOI 10.1016/j.bbrc.2014.02.128 · PubMed

Other PDB entries of the same protein (UniProt Q15599 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2HE4 1.45 Å, The crystal structure of the second PDZ domain of human NHERF-2 (SLC9A3R2) interacting…
2OCS 1.5 Å, The crystal structure of the first PDZ domain of human NHERF-2 (SLC9A3R2)
2D11 2.81 Å, Crystal structure of the Radixin FERM domain complexed with the NHERF-2 C-terminal tail…

Browse structure collections

About this viewer

MolViewer shows 4P0C directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.