4P3F: Human SRP68-RBD

Structure of the human SRP68-RBD. Determined by X-ray diffraction at 1.7 Å resolution. Released 16 Apr 2014.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,731
Mol. weight: 51.78 kDa
Released: 16 Apr 2014

Explore 4P3F in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4P3F contains 18 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	50	1	1
α-helix	54-64	11
α-helix	67-69	3
α-helix	72-95	24
α-helix	106-107	2
α-helix	114-135	22
α-helix	143-164	22
β-strand	170	1	1
α-helix	172-192	21
α-helix	196-214	19
α-helix	219-243	25

Chain B: 9 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	50	1	2
α-helix	54-64	11
α-helix	67-69	3
α-helix	72-95	24
β-strand	97	1	3
β-strand	104	1	3
α-helix	114-137	24
α-helix	141-143	3
α-helix	144-165	22
β-strand	170	1	2
α-helix	172-192	21
α-helix	196-215	20
α-helix	219-240	22

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Signal recognition particle subunit SRP68	A, B	protein	216	Homo sapiens	Q9UHB9 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4P3F_1 Signal recognition particle subunit SRP68 (chains A, B)
MGHHHHHHGSKANKEFGDSLSLEILQIIKESQQQHGLRHGDFQRYRGYCSRRQRRLRKTL
NFKMGNRHKFTGKKVTEDLLTDNRYLLLVLMDAERAWSYAMQLKQEANTEPRKRFHLLSR
LRKAVKHAEELERLCESNRVDAKTKLEAQAYTAYLSGMLRFEHQEWKAAIEAFNKCKTIY
EKLASAFTEEQAVLYNQRVEEISPNIRYCAYNIGDQ

Primary citation

SRP RNA remodeling by SRP68 explains its role in protein translocation. Grotwinkel, J.T., Wild, K., Segnitz, B. et al. Science (2014) 344:101-104. DOI 10.1126/science.1249094 · PubMed

Other PDB entries of the same protein (UniProt Q9UHB9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5M72 1.6 Å, Structure of the human SRP68-72 protein-binding domain complex
5WRV 1.7 Å, Complex structure of human SRP72/SRP68
8QVX 2.7 Å, Structure of the PBD of human SRP68/72 (cryoSPARC 3DFlex)
7QWQ 2.83 Å, Ternary complex of ribosome nascent chain with SRP and NAC
8QVW 3.0 Å, Cryo-EM structure of the peptide binding domain of human SRP68/72
7NFX 3.2 Å, Mammalian ribosome nascent chain complex with SRP and SRP receptor in early state A
5M73 3.4 Å, Structure of the human SRP S domain with SRP72 RNA-binding domain
4P3E 3.5 Å, Structure of the human SRP S domain

Browse structure collections

About this viewer

MolViewer shows 4P3F directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.