5WRV: Complex structure of human SRP72/SRP68

Complex structure of human SRP72/SRP68. Determined by X-ray diffraction at 1.7 Å resolution. Released 21 Jun 2017.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,709
Mol. weight: 30.9 kDa
Released: 21 Jun 2017

Explore 5WRV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5WRV contains 12 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	593-597	5
α-helix	600-602	3
α-helix	604-607	4

Chain B: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	11-23	13
α-helix	27-40	14
α-helix	45-57	13
α-helix	61-69	9
α-helix	81-90	10
α-helix	94-102	9
α-helix	109-121	13
α-helix	125-138	14
α-helix	144-159	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Signal recognition particle subunit SRP68	A	protein	106	Homo sapiens	Q9UHB9 (AlphaFold model)
Signal recognition particle subunit SRP72	B	protein	163	Homo sapiens	O76094 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5WRV_1 Signal recognition particle subunit SRP68 (chains A)
DLPDVQELITQVRSEKCSLQAAAILDANDAHQTETSSSQVKDNKPLVERFETFCLDPSLV
TKQANLVHFPPGFQPIPCKPLFFDLALNHVAFPPLEDKLAAATKSG

Sequence of entity 2 (B), FASTA

>5WRV_2 Signal recognition particle subunit SRP72 (chains B)
MASGGSGGVSVPALWSEVNRYGQNGDFTRALKTVNKILQINKDDVTALHCKVVCLIQNGS
FKEALNVINTHTKVLANNSLSFEKAYCEYRLNRIENALKTIESANQQTDKLKELYGQVLY
RLERYDECLAVYRDLVRNSQDDYDEERKTNLSAVVAAQSNWEK

Primary citation

Human apo-SRP72 and SRP68/72 complex structures reveal the molecular basis of protein translocation. Gao, Y., Zhang, Q., Lang, Y. et al. J Mol Cell Biol (2017) 9:220-230. DOI 10.1093/jmcb/mjx010 · PubMed

Other PDB entries of the same protein (UniProt Q9UHB9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5M72 1.6 Å, Structure of the human SRP68-72 protein-binding domain complex
4P3F 1.7 Å, Structure of the human SRP68-RBD
8QVX 2.7 Å, Structure of the PBD of human SRP68/72 (cryoSPARC 3DFlex)
7QWQ 2.83 Å, Ternary complex of ribosome nascent chain with SRP and NAC
8QVW 3.0 Å, Cryo-EM structure of the peptide binding domain of human SRP68/72
7NFX 3.2 Å, Mammalian ribosome nascent chain complex with SRP and SRP receptor in early state A
5M73 3.4 Å, Structure of the human SRP S domain with SRP72 RNA-binding domain
4P3E 3.5 Å, Structure of the human SRP S domain

Browse structure collections

About this viewer

MolViewer shows 5WRV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.