4PD3: Rigor-Like Human Nonmuscle Myosin-2B

Crystal Structure of Rigor-Like Human Nonmuscle Myosin-2B. Determined by X-ray diffraction at 2.84 Å resolution. Released 12 Nov 2014.

Method: X-ray diffraction
Resolution: 2.84 Å
Organisms: Homo sapiens, Dictyostelium discoideum
Chains: 2
Atoms: 14,828
Mol. weight: 237.43 kDa
Released: 12 Nov 2014

Explore 4PD3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4PD3 contains 82 α-helices and 51 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 40 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	35-39	5	1
β-strand	45-49	5	1
β-strand	53-54	2	1
β-strand	57-62	6	1
β-strand	68-72	5	1
β-strand	77	1	1
α-helix	82-84	3
β-strand	89	1	2
α-helix	90-92	3
α-helix	98-109	12
β-strand	115-118	4	2
β-strand	121-125	5	2
α-helix	136-141	6
α-helix	154-167	14
β-strand	172-178	7	2
α-helix	180-182	3
α-helix	184-198	15
α-helix	216-218	3
α-helix	221-229	9
β-strand	230-231	2	3
β-strand	239-240	2	3
β-strand	243-250	8	2
β-strand	256-264	9	2
α-helix	269-272	4
β-strand	281	1	3
α-helix	282-290	9
α-helix	293-298	6
α-helix	304-306	3
β-strand	317	1	4
β-strand	320	1	4
α-helix	322-335	14
α-helix	340-357	18
β-strand	362	1	5
β-strand	371	1	5
α-helix	379-384	6
α-helix	389-397	9
α-helix	414-442	29
β-strand	453-461	9	2
α-helix	471-501	31
α-helix	511-514	4
α-helix	516-522	7
α-helix	531-538	8
α-helix	546-556	11
β-strand	563-564	2	6
β-strand	575-578	4	6
β-strand	583-586	4	6
α-helix	591-594	4
β-strand	596	1	7
α-helix	601-608	8
α-helix	613-618	6
β-strand	652	1	7
α-helix	653-668	16
β-strand	672-679	8	2
α-helix	692-702	11
α-helix	704-711	8
β-strand	717-720	4	8
α-helix	721-728	8
α-helix	729-731	3
α-helix	745-754	10
β-strand	761-763	3	8
β-strand	767-770	4	8
α-helix	774-809	36
α-helix	818-830	13
α-helix	831-835	5
α-helix	836-840	5
α-helix	842-857	16
α-helix	873-924	52
α-helix	948-974	27
α-helix	981-1002	22

Chain B: 42 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	35-39	5	9
β-strand	45-49	5	9
β-strand	53-54	2	10
β-strand	57-58	2	10
α-helix	78-81	4
α-helix	82-84	3
β-strand	89	1	11
α-helix	90-92	3
α-helix	98-109	12
β-strand	115-118	4	11
β-strand	121-125	5	11
α-helix	136-141	6
α-helix	154-167	14
β-strand	172-178	7	11
α-helix	180-182	3
α-helix	184-198	15
α-helix	222-229	8
β-strand	230-231	2	12
β-strand	239-240	2	12
β-strand	243-250	8	11
β-strand	256-264	9	11
α-helix	269-272	4
β-strand	281	1	12
α-helix	282-290	9
α-helix	293-299	7
α-helix	304-306	3
α-helix	322-335	14
α-helix	340-357	18
α-helix	376-384	9
α-helix	389-397	9
α-helix	414-441	28
β-strand	453-461	9	11
β-strand	469	1	13
α-helix	471-501	31
α-helix	511-514	4
α-helix	516-522	7
α-helix	531-538	8
α-helix	546-556	11
β-strand	563-564	2	13
β-strand	575-578	4	13
β-strand	583-586	4	13
α-helix	591-594	4
α-helix	601-608	8
α-helix	613-618	6
α-helix	653-668	16
β-strand	672-679	8	11
α-helix	692-702	11
α-helix	704-713	10
β-strand	717-720	4	14
α-helix	721-728	8
α-helix	729-731	3
α-helix	737	1
α-helix	743-753	11
β-strand	761-763	3	14
β-strand	767-770	4	14
α-helix	774-809	36
α-helix	818-830	13
α-helix	831-835	5
α-helix	836-857	22
α-helix	873-915	43
α-helix	917-923	7
α-helix	940-945	6
α-helix	948-975	28
α-helix	983-1018	36

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nonmuscle myosin heavy chain B, Alpha-actinin A Chimera Protein	A, B	protein	1032	Homo sapiens, Dictyostelium discoideum	P05095 (AlphaFold model), P35580 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4PD3_1 Nonmuscle myosin heavy chain B, Alpha-actinin A Chimera Protein (chains A, B)
MAQRTGLEDPERYLFVDRAVIYNPATQADWTAKKLVWIPSERHGFEAASIKEERGDEVMV
ELAENGKKAMVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKDRYYSGLIYTYSGL
FCVVINPYKNLPIYSENIIEMYRGKKRHEMPPHIYAISESAYRCMLQDREDQSILCTGES
GAGKTENTKKVIQYLAHVASSHKGRKDHNIPGELERQLLQANPILESFGNAKTVKNDNSS
RFGKFIRINFDVTGYIVGANIETYLLEKSRAVRQAKDERTFHIFYQLLSGAGEHLKSDLL
LEGFNNYRFLSNGYIPIPGQQDKDNFQETMEAMHIMGFSHEEILSMLKVVSSVLQFGNIS
FKKERNTDQASMPENTVAQKLCHLLGMNVMEFTRAILTPRIKVGRDYVQKAQTKEQADFA
VEALAKATYERLFRWLVHRINKALDRTKRQGASFIGILDIAGFEIFELNSFEQLCINYTN
EKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIERPANPPGVLALLDEECW
FPKATDKTFVEKLVQEQGSHSKFQKPRQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLN
DNVATLLHQSSDRFVAELWKDVDRIVGLDQVTGMTETAFGSAYKTKKGMFRTVGQLYKES
LTKLMATLRNTNPNFVRCIIPNHEKRAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRIV
FQEFRQRYEILTPNAIPKGFMDGKQACERMIRALELDPNLYRIGQSKIFFRAGVLAHLEE
ERASEQTKSDYLKRANELVQWINDKQASLESRDFGDSIESVQSFMNAHKEYKKTEKPPKG
QEVSELEAIYNSLQTKLRLIKREPFVAPAGLTPNEIDSTWSALEKAEQEHAEALRIELKR
QKKIAVLLQKYNRILKKLENWATTKSVYLGSNETGDSITAVQAKLKNLEAFDGECQSLEG
QSNSDLLSILAQLTELNYNGVPELTERKDTFFAQQWTGVKSSAETYKNTLLAELERLQKI
EDALHHHHHHHH

Primary citation

Crystal structure of the rigor-like human non-muscle myosin-2 motor domain. Munnich, S., Pathan-Chhatbar, S., Manstein, D.J. FEBS Lett (2014) 588:4754-4760. DOI 10.1016/j.febslet.2014.11.007 · PubMed

Other PDB entries of the same protein (UniProt P05095 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9IHL 2.02 Å, Crystal Structure of the Human Nonmuscle Myosin 2A Motor Domain
5I4E 2.25 Å, Crystal Structure of Human Nonmuscle Myosin 2C motor domain
1G8X 2.8 Å, Structure of a genetically engineered molecular motor
5JLH 3.9 Å, Cryo-EM structure of a human cytoplasmic actomyosin complex at near-atomic resolution

Browse structure collections

About this viewer

MolViewer shows 4PD3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.