Crystal structure of TNKS-2 in complex with DR2313. Determined by X-ray diffraction at 1.5 Å resolution. Released 15 Oct 2014.
Explore 4PNL in 3D Show helices and sheets RCSB PDB PDBe
4PNL contains 37 α-helices and 46 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 964-974 | 11 | |
| β-strand | 992-999 | 8 | 1 |
| α-helix | 1003-1018 | 16 | |
| β-strand | 1026-1031 | 6 | 1 |
| α-helix | 1036-1042 | 7 | |
| α-helix | 1046-1048 | 3 | |
| β-strand | 1056 | 1 | 2 |
| β-strand | 1059-1061 | 3 | 3 |
| β-strand | 1062 | 1 | 1 |
| α-helix | 1065-1069 | 5 | |
| α-helix | 1075-1077 | 3 | |
| α-helix | 1093 | 1 | |
| β-strand | 1094-1102 | 9 | 1 |
| β-strand | 1106-1109 | 4 | 3 |
| β-strand | 1115 | 1 | 2 |
| α-helix | 1118-1119 | 2 | |
| β-strand | 1124-1127 | 4 | 3 |
| β-strand | 1138-1141 | 4 | 3 |
| α-helix | 1144-1146 | 3 | |
| β-strand | 1147-1157 | 11 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 955-956 | 2 | 4 |
| α-helix | 963-974 | 12 | |
| β-strand | 992-1000 | 9 | 4 |
| α-helix | 1003-1018 | 16 | |
| β-strand | 1026-1031 | 6 | 4 |
| α-helix | 1036-1042 | 7 | |
| α-helix | 1046-1048 | 3 | |
| β-strand | 1056 | 1 | 5 |
| β-strand | 1059-1061 | 3 | 6 |
| β-strand | 1062 | 1 | 4 |
| α-helix | 1065-1069 | 5 | |
| α-helix | 1075-1077 | 3 | |
| β-strand | 1094-1102 | 9 | 4 |
| β-strand | 1106-1109 | 4 | 6 |
| β-strand | 1115 | 1 | 5 |
| α-helix | 1118-1119 | 2 | |
| β-strand | 1124-1127 | 4 | 6 |
| β-strand | 1138-1141 | 4 | 6 |
| α-helix | 1144-1146 | 3 | |
| β-strand | 1147-1157 | 11 | 4 |
| α-helix | 1158-1159 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 955-957 | 3 | 7 |
| α-helix | 963-974 | 12 | |
| β-strand | 992-1000 | 9 | 7 |
| α-helix | 1003-1018 | 16 | |
| β-strand | 1026-1031 | 6 | 7 |
| α-helix | 1036-1042 | 7 | |
| α-helix | 1046-1048 | 3 | |
| β-strand | 1051 | 1 | 8 |
| β-strand | 1053 | 1 | 8 |
| β-strand | 1059-1061 | 3 | 9 |
| β-strand | 1062 | 1 | 7 |
| α-helix | 1065-1069 | 5 | |
| α-helix | 1075-1077 | 3 | |
| α-helix | 1093 | 1 | |
| β-strand | 1094-1102 | 9 | 7 |
| β-strand | 1106-1109 | 4 | 9 |
| α-helix | 1118-1119 | 2 | |
| β-strand | 1124-1127 | 4 | 9 |
| α-helix | 1128-1129 | 2 | |
| β-strand | 1138-1141 | 4 | 9 |
| α-helix | 1144-1146 | 3 | |
| β-strand | 1147-1157 | 11 | 7 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 966-974 | 9 | |
| β-strand | 991-999 | 9 | 10 |
| α-helix | 1003-1019 | 17 | |
| β-strand | 1026-1031 | 6 | 10 |
| α-helix | 1036-1042 | 7 | |
| α-helix | 1046-1048 | 3 | |
| β-strand | 1056 | 1 | 11 |
| β-strand | 1059-1061 | 3 | 12 |
| β-strand | 1062 | 1 | 10 |
| α-helix | 1065-1069 | 5 | |
| α-helix | 1075-1077 | 3 | |
| α-helix | 1093 | 1 | |
| β-strand | 1094-1102 | 9 | 10 |
| β-strand | 1106-1109 | 4 | 12 |
| β-strand | 1115 | 1 | 11 |
| α-helix | 1118-1119 | 2 | |
| β-strand | 1124-1127 | 4 | 12 |
| β-strand | 1138-1141 | 4 | 12 |
| α-helix | 1144-1146 | 3 | |
| β-strand | 1147-1158 | 12 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Tankyrase-2 | A, B, C, D | protein | 227 | Homo sapiens | Q9H2K2 (AlphaFold model) |
>4PNL_1 Tankyrase-2 (chains A, B, C, D) MGSSHHHHHHSSGRENLYFQGSPDDKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKI QKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGA GIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMKMAH SPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPEGMV
| ID | Name | Formula | Copies |
|---|---|---|---|
| DRL | 2-methyl-3,5,7,8-tetrahydro-4H-thiopyrano[4,3-d]pyrimidin-4-one | C8 H10 N2 O S | 4 |
| ZN | Zinc ion | Zn | 4 |
Water and common crystallization additives (DMS, EDO) are not listed.
Insights into the binding of PARP inhibitors to the catalytic domain of human tankyrase-2. Qiu, W., Lam, R., Voytyuk, O. et al. Acta Crystallogr D Biol Crystallogr (2014) 70:2740-2753. DOI 10.1107/S1399004714017660 · PubMed
Other PDB entries of the same protein (UniProt Q9H2K2 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4PNL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.