4PVZ: Yeast importin a

Structure of yeast importin a bound to the membrane protein Nuclear Localization Signal sequence of INM protein Heh2. Determined by X-ray diffraction at 2.5 Å resolution. Released 26 Aug 2015.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Saccharomyces cerevisiae S288c
Chains: 4
Atoms: 7,279
Mol. weight: 103.55 kDa
Released: 26 Aug 2015

Explore 4PVZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4PVZ contains 71 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 34 helices, 0 β-strands

Element	Residues	Length
α-helix	89-96	8
α-helix	101-115	15
α-helix	123-128	6
α-helix	132-137	6
α-helix	145-158	14
α-helix	163-171	9
α-helix	174-184	11
α-helix	187-201	15
α-helix	205-213	9
α-helix	217-222	6
α-helix	223-225	3
α-helix	229-243	15
α-helix	249-250	2
α-helix	252-255	4
α-helix	256-258	3
α-helix	259-265	7
α-helix	271-284	14
α-helix	289-297	9
α-helix	300-307	8
α-helix	313-326	14
α-helix	331-339	9
α-helix	342-349	8
α-helix	355-368	14
α-helix	373-381	9
α-helix	385-394	10
α-helix	397-411	15
α-helix	412-414	3
α-helix	419-426	8
α-helix	430-439	10
α-helix	442-464	23
α-helix	472-479	8
α-helix	482-488	7
α-helix	489-491	3
α-helix	495-508	14

Chain B: 35 helices, 0 β-strands

Element	Residues	Length
α-helix	89-96	8
α-helix	101-114	14
α-helix	123-128	6
α-helix	132-137	6
α-helix	145-158	14
α-helix	163-171	9
α-helix	174-184	11
α-helix	187-201	15
α-helix	205-213	9
α-helix	217-222	6
α-helix	223-225	3
α-helix	229-243	15
α-helix	249-250	2
α-helix	252-255	4
α-helix	256-258	3
α-helix	259-265	7
α-helix	271-284	14
α-helix	289-297	9
α-helix	300-306	7
α-helix	307-309	3
α-helix	313-326	14
α-helix	331-339	9
α-helix	342-349	8
α-helix	355-368	14
α-helix	373-381	9
α-helix	385-394	10
α-helix	397-411	15
α-helix	412-414	3
α-helix	419-426	8
α-helix	430-439	10
α-helix	442-464	23
α-helix	472-479	8
α-helix	482-488	7
α-helix	489-491	3
α-helix	495-508	14

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	113-118	6

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	105-108	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Importin subunit alpha	A, B	protein	422	Saccharomyces cerevisiae S288c	Q02821 (AlphaFold model)
Inner nuclear membrane protein HEH2	C, D	protein	43	Saccharomyces cerevisiae S288c	Q03281 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4PVZ_1 Importin subunit alpha (chains A, B)
ELPQMTQQLNSDDMQEQLSATVKFRQILSREHRPPIDVVIQAGVVPRLVEFMRENQPEML
QLEAAWALTNIASGTSAQTKVVVDADAVPLFIQLLYTGSVEVKEQAIWALGNVAGDSTDY
RDYVLQCNAMEPILGLFNSNKPSLIRTATWTLSNLCRGKKPQPDWSVVSQALPTLAKLIY
SMDTETLVDACWAISYLSDGPQEAIQAVIDVRIPKRLVELLSHESTLVQTPALRAVGNIV
TGNDLQTQVVINAGVLPALRLLLSSPKENIKKEACWTISNITAGNTEQIQAVIDANLIPP
LVKLLEVAEYKTKKEACWAISNASSGGLQRPDIIRYLVSQGCIKPLCDLLEIADNRIIEV
TLDALENILKMGEADKEARGLNINENADFIEKAGGMEKIFNCQQNENDKIYEKAYKIIET
YF

Sequence of entity 2 (C, D), FASTA

>4PVZ_2 Inner nuclear membrane protein HEH2 (chains C, D)
GPLGSTNKRKREQISTDNEAKMQIQEEKSPKKKRKKRSSKANK

Primary citation

Distinctive Properties of the Nuclear Localization Signals of Inner Nuclear Membrane Proteins Heh1 and Heh2. Lokareddy, R.K., Hapsari, R.A., van Rheenen, M. et al. Structure (2015) 23:1305-1316. DOI 10.1016/j.str.2015.04.017 · PubMed

Other PDB entries of the same protein (UniProt Q02821 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1WA5 2.0 Å, Structure of the Cse1:Imp-alpha:RanGTP complex
1EE4 2.1 Å, Crystal structure of yeast karyopherin (importin) alpha in a complex with a C-myc nls…
1BK5 2.2 Å, Karyopherin alpha from saccharomyces cerevisiae
5H2X 2.2 Å, Crystal structure of the karyopherin Kap60p bound to the SUMO protease Ulp1p (150-172)
4XZR 2.25 Å, Structure of yeast importin a bound to the membrane protein Nuclear Localization Signal…
1EE5 2.4 Å, Yeast karyopherin (importin) alpha in a complex with a nucleoplasmin nls peptide
5H2W 2.5 Å, Crystal structure of the karyopherin Kap60p bound to the SUMO protease Ulp1p (150-340)
1UN0 2.6 Å, Crystal Structure of Yeast Karyopherin (Importin) alpha in complex with a Nup2p…
2C1T 2.6 Å, Structure of the Kap60p:Nup2 complex
5T94 2.63 Å, Crystal structure of Kap60 bound to yeast RCC1 (Prp20)
1BK6 2.8 Å, Karyopherin alpha (YEAST) + SV40 T antigen nls

Browse structure collections

About this viewer

MolViewer shows 4PVZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.