4PXT: Bipolar kinesin KRP-130

Structural basis for the assembly of the mitotic motor kinesin-5 into bipolar tetramers. Determined by X-ray diffraction at 2.9 Å resolution. Released 23 Apr 2014.

Method: X-ray diffraction
Resolution: 2.9 Å
Organism: Drosophila melanogaster
Chains: 2
Atoms: 2,518
Mol. weight: 49.97 kDa
Released: 23 Apr 2014

Explore 4PXT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4PXT contains 5 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	642-695	54
α-helix	698-796	99

Chain B: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	651-663	13
α-helix	665-695	31
α-helix	698-795	98

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Bipolar kinesin KRP-130	A, B	protein	211	Drosophila melanogaster	P46863 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4PXT_1 Bipolar kinesin KRP-130 (chains A, B)
MQQQQLLMSKEIQTNLQVIEENNQRHKAMLDSMQEKFATIIDSSLQSVEEHAKQMHKKLE
QLGAMSLPDAEELQNLQEELANERALAQQEDALLESMMMQMEQIKNLRSKNSISMSVHLN
KMEESRLTRNHRIDDIKSGIQDYQKLGIEASQSAQAELTSQMEAGMLCLDQGVANCSMLQ
VHMKNLNQKYEKETNENVGSVRVSGHHHHHH

Primary citation

Structural basis for the assembly of the mitotic motor Kinesin-5 into bipolar tetramers. Scholey, J.E., Nithianantham, S., Scholey, J.M. et al. Elife (2014) 3:e02217-e02217. PubMed

Other PDB entries of the same protein (UniProt P46863 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7LXR 1.74 Å, Kinesin-like protein at 61F (Klp61f) bound to AMPPNP
4PXU 2.6 Å, Structural basis for the assembly of the mitotic motor kinesin-5 into bipolar tetramers
6VPO 4.4 Å, Cryo-EM structure of microtubule-bound KLP61F motor domain in the AMPPNP state
6VPP 4.4 Å, Cryo-EM structure of microtubule-bound KLP61F motor with tail domain in the…
7S5U 4.41 Å, Extended bipolar assembly domain of kinesin-5 minifilament
2WBE 9.4 Å, Kinesin-5-Tubulin Complex with AMPPNP

Browse structure collections

About this viewer

MolViewer shows 4PXT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.