7S5U: Kinesin-like protein Klp61F

Extended bipolar assembly domain of kinesin-5 minifilament. Determined by X-ray diffraction at 4.41 Å resolution. Released 15 Mar 2023.

Method: X-ray diffraction
Resolution: 4.41 Å
Organism: Drosophila melanogaster
Chains: 4
Atoms: 5,023
Mol. weight: 113.73 kDa
Released: 15 Mar 2023

Explore 7S5U in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7S5U contains 13 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	622	1
α-helix	623-627	5
α-helix	628-643	16
α-helix	646-697	52
α-helix	700-790	91
α-helix	792-794	3

Chain B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	624-697	74
α-helix	700-797	98

Chain C: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	621-697	77
α-helix	700-790	91

Chain D: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	625-645	21
α-helix	647-697	51
α-helix	700-787	88

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Kinesin-like protein Klp61F	A, B, C, D	protein	248	Drosophila melanogaster	P46863 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>7S5U_1 Kinesin-like protein Klp61F (chains A, B, C, D)
MAQSLQDQTNLHNKLIGEVMKISDQHSQAFVAKLMEQMQQQQLLMSKEIQTNLQVIEENN
QRHKAMLDSMQEKFATIIDSSLQSVEEHAKQMHKKLEQLGAMSLPDAEELQNLQEELANE
RALAQQEDALLESMMMQMEQIKNLRSKNSISMSVHLNKMEESRLTRNHRIDDIKSGIQDY
QKLGIEASQSAQAELTSQMEAGMLCLDQGVANCSMLQVHMKNLNQKYEKETNENVGSVRV
SGHHHHHH

Primary citation

The kinesin-5 tail and bipolar miniflament domains are the origin of its microtubule crosslinking and sliding activity. Nithianantham, S., Iwanski, M.K., Gaska, I. et al. Mol Biol Cell (2023):mbcE23070287-mbcE23070287. DOI 10.1091/mbc.E23-07-0287 · PubMed

Other PDB entries of the same protein (UniProt P46863 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7LXR 1.74 Å, Kinesin-like protein at 61F (Klp61f) bound to AMPPNP
4PXU 2.6 Å, Structural basis for the assembly of the mitotic motor kinesin-5 into bipolar tetramers
4PXT 2.9 Å, Structural basis for the assembly of the mitotic motor kinesin-5 into bipolar tetramers
6VPO 4.4 Å, Cryo-EM structure of microtubule-bound KLP61F motor domain in the AMPPNP state
6VPP 4.4 Å, Cryo-EM structure of microtubule-bound KLP61F motor with tail domain in the…
2WBE 9.4 Å, Kinesin-5-Tubulin Complex with AMPPNP

Browse structure collections

About this viewer

MolViewer shows 7S5U directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.