4PXZ: P2Y12 receptor

Crystal structure of P2Y12 receptor in complex with 2MeSADP. Determined by X-ray diffraction at 2.5 Å resolution. Released 30 Apr 2014.

Method: X-ray diffraction
Resolution: 2.5 Å
Organisms: Homo sapiens, Escherichia coli
Chains: 1
Atoms: 3,302
Mol. weight: 55.28 kDa
Ligands: 6AD, CLR, OLC
Released: 30 Apr 2014

Explore 4PXZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4PXZ contains 22 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 22 helices, 0 β-strands

Element	Residues	Length
α-helix	24-50	27
α-helix	58-74	17
α-helix	77-85	9
α-helix	91-95	5
α-helix	96-100	5
α-helix	101-127	27
α-helix	136-161	26
α-helix	165-167	3
α-helix	175-178	4
α-helix	181-1018	61
α-helix	1023-1041	19
α-helix	1056-1079	24
α-helix	1084-1091	8
α-helix	1092-1095	4
α-helix	1097-226	13
α-helix	229-230	2
α-helix	231-233	3
α-helix	236-244	9
α-helix	245-249	5
α-helix	250-264	15
α-helix	270-293	24
α-helix	296-299	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
P2Y purinoceptor 12, Soluble cytochrome b562	A	protein	466	Homo sapiens, Escherichia coli	P0ABE7 (AlphaFold model), Q9H244 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4PXZ_1 P2Y purinoceptor 12, Soluble cytochrome b562 (chains A)
DYKDDDDGAPQAVDNLTSAPGNTSLCTRDYKITQVLFPLLYTVLFFVGLITNGLAMRIFF
QIRSKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGTGPLRTFVCQVTSVIFYFTMYIS
ISFLGLITIDRYQKTTRPFKTSNPKNLLGAKILSVVIWAFMFLLSLPNMILTNRQPRDKN
VKKCSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYRSYVRTADLEDNWE
TLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDIL
VGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLRGVGKVPRKKVNVKVFIIIAVF
FICFVPFHFARIPYTLSQTRDVFDCTAENTLFYVKESTLWLTSLNACLNPFIYFFLCKSF
RNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPMGRPLEVLFQ

Ligands and cofactors

ID	Name	Formula	Copies
6AD	2-(methylsulfanyl)adenosine 5'-(trihydrogen diphosphate)	C11 H17 N5 O10 P2 S	1
CLR	Cholesterol	C27 H46 O	1
OLC	(2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate	C21 H40 O4	3

Water and common crystallization additives (PEG) are not listed.

Primary citation

Agonist-bound structure of the human P2Y12 receptor. Zhang, J., Zhang, K., Gao, Z.G. et al. Nature (2014) 509:119-122. DOI 10.1038/nature13288 · PubMed

Other PDB entries of the same protein (UniProt P0ABE7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6DYF 1.1 Å, Cu(II)-bound structure of the engineered cyt cb562 variant, CH3Y
5YO6 1.2 Å, Crystal Structure of B562RIL with engineered disulfide bond T9C-A36C
4JEA 1.22 Å, Crystal structure of an engineered Zn-RIDC1 construct with four interfacial disulfide…
7LSJ 1.26 Å, Cu-bound crystal structure of the engineered cyt cb562 variant, DiCyt2 - H63A,…
7MK4 1.27 Å, Co-bound crystal structure of the engineered cyt cb562 variant, DiCyt2
6DYC 1.33 Å, Co(II)-bound structure of the engineered cyt cb562 variant, CH3
5YO4 1.37 Å, Crystal Structure of B562RIL with engineered disulfide bond K27C-A79C
256B 1.4 Å, Improvement of the 2.5 Å resolution model of cytochrome B562 by redetermining the…
6OT4 1.4 Å, Bimetallic dodecameric cage design 2 (BMC2) from cytochrome cb562
7LRV 1.4 Å, Ni-bound crystal structure of the engineered cyt cb562 variant, DiCyt2, crystallized in…
9PQ4 1.48 Å, Bi-bound structure of the H77C variant of TriCyt2
6DYG 1.49 Å, Fe(II)-bound structure of the engineered cyt cb562 variant, CH3Y

Browse structure collections

About this viewer

MolViewer shows 4PXZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.