Crystal structure of chromodomain of Rhino. Determined by X-ray diffraction at 1.5 Å resolution. Released 20 Aug 2014.
Explore 4QUC in 3D Show helices and sheets RCSB PDB PDBe
4QUC contains 3 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 26-35 | 10 | 1 |
| β-strand | 38-45 | 8 | 1 |
| α-helix | 50-52 | 3 | |
| β-strand | 54-57 | 4 | 1 |
| α-helix | 58-60 | 3 | |
| α-helix | 65-77 | 13 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| RE36324p | A | protein | 68 | Drosophila melanogaster | Q7JXA8 (AlphaFold model) |
>4QUC_1 RE36324p (chains A) SDHVEEYVVEKILGKRFVNGRPQVLVKWSGFPNENNTWEPLENVGNCMKLVSDFESEVFR LHRKAAAK
Transgenerationally inherited piRNAs trigger piRNA biogenesis by changing the chromatin of piRNA clusters and inducing precursor processing. Le Thomas, A., Stuwe, E., Li, S. et al. Genes Dev (2014) 28:1667-1680. DOI 10.1101/gad.245514.114 · PubMed
Other PDB entries of the same protein (UniProt Q7JXA8 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4QUC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.