5XYV: Rhino

Crystal structure of drosophila melanogaster Rhino chromoshadow domain in complex with Deadlock N-terminal domain. Determined by X-ray diffraction at 2.1 Å resolution. Released 20 Jun 2018.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Drosophila melanogaster
Chains: 4
Atoms: 1,931
Mol. weight: 31.37 kDa
Released: 20 Jun 2018

Explore 5XYV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5XYV contains 14 α-helices and 9 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	357-360	4
β-strand	364-373	10	1
β-strand	376-383	8	1
β-strand	389-393	5	1
α-helix	394-397	4
α-helix	402-410	9
β-strand	413-415	3	2

Chain B: 4 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	357-360	4
α-helix	362-363	2
β-strand	364-373	10	3
β-strand	376-383	8	3
β-strand	389-393	5	3
α-helix	394-396	3
α-helix	402-411	10
β-strand	413-415	3	2

Chain C: 4 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	4-6	3
α-helix	9-23	15
α-helix	25-27	3
α-helix	30-45	16
β-strand	49-51	3	2

Chain D: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	9-23	15
α-helix	25-27	3
α-helix	30-42	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Rhino	A, B	protein	78	Drosophila melanogaster	Q7JXA8 (AlphaFold model)
Protein deadlock	C, D	protein	60	Drosophila melanogaster	Q9VIF5 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5XYV_1 RHINO (chains A, B)
GSTKPFGVNRGLDLDKILHCYQMNDDLFMFVTWKGCSSIDAVHINDIKEAYPLQIIKYFE
SLRIIVPKGSGSGSGSGS

Sequence of entity 2 (C, D), FASTA

>5XYV_2 Protein deadlock (chains C, D)
MEKLDKIRMSQKLSCWQHILTTLGTSSKTEQEWNTFFKGFLESWRKPYCIQTSCDPSIPL

Primary citation

Structural insights into Rhino-Deadlock complex for germline piRNA cluster specification. Yu, B., Lin, Y.A., Parhad, S.S. et al. EMBO Rep (2018) 19. DOI 10.15252/embr.201745418 · PubMed

Other PDB entries of the same protein (UniProt Q7JXA8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4QUC 1.5 Å, Crystal structure of chromodomain of Rhino
4U68 1.8 Å, Crystal structure of Rhino chromodomain in complex with H3K9me3
4QUF 2.5 Å, crystal structure of chromodomain of Rhino with H3K9me3

Browse structure collections

About this viewer

MolViewer shows 5XYV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.