Crystal structure of the Olfactomedin domain of latrophilin 3 in P65 crystal form. Determined by X-ray diffraction at 1.61 Å resolution. Released 19 Aug 2015.
Explore 4RMK in 3D Show helices and sheets RCSB PDB PDBe
4RMK contains 3 α-helices and 24 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 201-203 | 3 | |
| β-strand | 206-218 | 13 | 1 |
| β-strand | 224-227 | 4 | 2 |
| β-strand | 237-241 | 5 | 2 |
| β-strand | 249-253 | 5 | 2 |
| α-helix | 256-261 | 6 | |
| β-strand | 266-269 | 4 | 2 |
| β-strand | 274 | 1 | 3 |
| β-strand | 280-282 | 3 | 4 |
| β-strand | 285-289 | 5 | 4 |
| β-strand | 290 | 1 | 3 |
| β-strand | 295-300 | 6 | 4 |
| β-strand | 305-311 | 7 | 4 |
| β-strand | 315 | 1 | 5 |
| β-strand | 332-336 | 5 | 6 |
| β-strand | 339-345 | 7 | 6 |
| β-strand | 346 | 1 | 5 |
| β-strand | 352-358 | 7 | 6 |
| β-strand | 365-374 | 10 | 6 |
| α-helix | 375-377 | 3 | |
| β-strand | 380-384 | 5 | 7 |
| β-strand | 387-392 | 6 | 7 |
| β-strand | 406-412 | 7 | 7 |
| β-strand | 417-424 | 8 | 7 |
| β-strand | 432-438 | 7 | 1 |
| β-strand | 443-448 | 6 | 1 |
| β-strand | 451-460 | 10 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Latrophilin-3 | A | protein | 321 | Mus musculus | Q80TS3 (AlphaFold model) |
>4RMK_1 Latrophilin-3 (chains A) APSTDHLDYKDDDDKAAAKVFLCPGLLKGVYQSEHLFESDHQSGAWCKDPLQASDKIYYM PWTPYRTDTLTEYSSKDDFIAGRPTTTYKLPHRVDGTGFVVYDGALFFNKERTRNIVKFD LRTRIKSGEAIIANANYHDTSPYRWGGKSDIDLAVDENGLWVIYATEQNNGKIVISQLNP YTLRIEGTWDTAYDKRSASNAFMICGILYVVKSVYEDDDNEATGNKIDYIYNTDQSKDSL VDVPFPNSYQYIAAVDYNPRDNLLYVWNNYHVVKYSLDFGPLDSRSGPVHHGQVSYISPP IHLDSELERPPVRGILEVLFQ
| ID | Name | Formula | Copies |
|---|---|---|---|
| CA | Calcium ion | Ca | 1 |
Structural and Mechanistic Insights into the Latrophilin3-FLRT3 Complex that Mediates Glutamatergic Synapse Development. Ranaivoson, F.M., Liu, Q., Martini, F. et al. Structure (2015) 23:1665-1677. DOI 10.1016/j.str.2015.06.022 · PubMed
Other PDB entries of the same protein (UniProt Q80TS3 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4RMK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.