4RUE: Potassium channel subfamily K member 4

Human K2P4.1 (TRAAK) potassium channel, G124I mutant. Determined by X-ray diffraction at 3.3 Å resolution. Released 17 Dec 2014.

Method: X-ray diffraction
Resolution: 3.3 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,893
Mol. weight: 67.52 kDa
Released: 17 Dec 2014

Explore 4RUE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4RUE contains 22 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	31-54	24
α-helix	65-75	11
α-helix	81-95	15
α-helix	116-127	12
α-helix	140-173	34
α-helix	176-180	5
α-helix	190-206	17
α-helix	207-211	5
α-helix	212-220	9
α-helix	225-236	12
α-helix	257-278	22

Chain B: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	29-74	46
α-helix	81-89	9
α-helix	90-94	5
α-helix	116-127	12
α-helix	136-137	2
α-helix	140-182	43
α-helix	190-206	17
α-helix	207-211	5
α-helix	212-217	6
α-helix	225-236	12
α-helix	257-282	26

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Potassium channel subfamily K member 4	A, B	protein	309	Homo sapiens	Q9NYG8 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4RUE_1 Potassium channel subfamily K member 4 (chains A, B)
MTTAPQEPPARPLQAGSGAGPAPGRAMRSTTLLALLALVLLYLVSGALVFRALEQPHEQQ
AQRELGEVREKFLRAHPCVSDQELGLLIKEVADALGGGADPETQSTSQSSHSAWDLGSAF
FFSITIITTIGYGNVALRTDAGRLFCIFYALVGIPLFGILLAGVGDRLGSSLRHGIGHIE
AIFLKWHVPPELVRVLSAMLFLLIGCLLFVLTPTFVFCYMEDWSKLEAIYFVIVTLTTVG
FGDYVAGADPRQDSPAYQPLVWFWILLGLAYFASVLTTIGNWLRVVSRRTRAEMGGLTAQ
SNSLEVLFQ

Primary citation

Transmembrane Helix Straightening and Buckling Underlies Activation of Mechanosensitive and Thermosensitive K2P Channels. Lolicato, M., Riegelhaupt, P.M., Arrigoni, C. et al. Neuron (2014) 84:1198-1212. DOI 10.1016/j.neuron.2014.11.017 · PubMed

Other PDB entries of the same protein (UniProt Q9NYG8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7LJ5 2.26 Å, Human TRAAK K+ channel FHIEG mutant A198E in a K+ bound conductive conformation
4WFE 2.5 Å, Human TRAAK K+ channel in a K+ bound conductive conformation
4WFF 2.5 Å, Human TRAAK K+ channel in a K+ bound nonconductive conformation
4I9W 2.75 Å, Human two pore domain K+ channel TRAAK (K2P4.1) - Fab complex structure
7LJA 2.77 Å, Human TRAAK K+ channel FHEIG mutant A198E in a Tl+ bound conductive conformation
7LJ4 2.78 Å, Human TRAAK K+ channel FHEIG mutant A270P in a K+ bound conductive conformation
7LJB 2.97 Å, Human TRAAK K+ channel mutant G158D in a K+ bound conductive conformation
4WFG 3.0 Å, Human TRAAK K+ channel in a Tl+ bound conductive conformation
4WFH 3.01 Å, Human TRAAK K+ channel in a Tl+ bound nonconductive conformation
3UM7 3.31 Å, Crystal structure of the human two pore domain K+ ion channel TRAAK (K2P4.1)
4RUF 3.4 Å, Human K2P4.1 (TRAAAK) potassium channel, W262S mutant

Browse structure collections

About this viewer

MolViewer shows 4RUE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.