7LJA: PDB entry 7LJA

Human TRAAK K+ channel FHEIG mutant A198E in a Tl+ bound conductive conformation. Determined by X-ray diffraction at 2.77 Å resolution. Released 30 Jun 2021.

Method: X-ray diffraction
Resolution: 2.77 Å
Organisms: Homo sapiens, Mus musculus
Chains: 6
Atoms: 10,651
Mol. weight: 160.04 kDa
Ligands: CA, TL
Released: 30 Jun 2021

Explore 7LJA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7LJA contains 45 α-helices and 87 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	29-54	26
α-helix	55-57	3
α-helix	60-75	16
α-helix	81-97	17
α-helix	116-127	12
α-helix	140-184	45
α-helix	190-206	17
α-helix	207-211	5
α-helix	212-220	9
α-helix	225-236	12
α-helix	257-285	29

Chain B: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	29-75	47
α-helix	81-96	16
α-helix	116-127	12
α-helix	140-185	46
α-helix	190-206	17
α-helix	207-211	5
α-helix	212-221	10
α-helix	225-236	12
α-helix	257-286	30

Chain D: 5 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	4-5	2	1
β-strand	10-13	4	2
β-strand	19-25	7	1
β-strand	33-37	5	2
β-strand	44-48	5	2
β-strand	52-53	2	2
β-strand	61-66	6	1
β-strand	69-74	6	1
β-strand	84-89	6	2
α-helix	95	1
β-strand	96-97	2	2
β-strand	101-105	5	2
β-strand	110	1	3
β-strand	113-117	5	4
α-helix	118-120	3
α-helix	121-124	4
β-strand	128-138	11	4
β-strand	139	1	3
β-strand	144-149	6	5
β-strand	152-154	3	5
β-strand	158-162	5	4
α-helix	163-164	2
β-strand	172-181	10	4
α-helix	182-187	6
β-strand	190-196	7	5
β-strand	204-209	6	5

Chain E: 8 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	6
α-helix	7-9	3
β-strand	10-12	3	7
β-strand	18-25	8	6
α-helix	29-31	3
β-strand	34-39	6	7
β-strand	45-51	7	7
β-strand	58-60	3	7
α-helix	62-64	3
β-strand	68-73	6	6
β-strand	78-83	6	6
α-helix	88-90	3
β-strand	92-98	7	7
β-strand	105-106	2	7
β-strand	110-114	5	7
β-strand	120	1	8
α-helix	121-122	2
β-strand	123-127	5	9
β-strand	138-148	11	9
β-strand	149	1	8
β-strand	154-157	4	10
α-helix	158-160	3
β-strand	166-168	3	9
α-helix	169-171	3
β-strand	172-174	3	9
β-strand	177-187	11	9
β-strand	196-202	7	10
α-helix	203-205	3
β-strand	207-213	7	10

Chain F: 7 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	4-5	2	11
β-strand	10-13	4	12
β-strand	19-25	7	11
β-strand	33-37	5	12
β-strand	44-48	5	12
β-strand	52-53	2	12
β-strand	61-66	6	11
β-strand	69-74	6	11
α-helix	79-81	3
β-strand	83-89	7	12
α-helix	95	1
β-strand	96-97	2	12
β-strand	101-105	5	12
α-helix	106	1
β-strand	110	1	13
β-strand	113-117	5	14
α-helix	121-125	5
β-strand	128-138	11	14
β-strand	139	1	13
β-strand	143-149	7	15
β-strand	152-154	3	15
β-strand	158-162	5	14
α-helix	163-166	4
β-strand	172-181	10	14
α-helix	182-187	6
β-strand	190-197	8	15
α-helix	203	1
β-strand	204-209	6	15

Chain G: 5 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	16
β-strand	10-12	3	17
β-strand	18-19	2	16
β-strand	22-25	4	16
α-helix	29-31	3
β-strand	34-39	6	18
β-strand	46-51	6	18
β-strand	58-60	3	18
α-helix	62-64	3
β-strand	68-73	6	16
β-strand	78-83	6	16
α-helix	88-90	3
β-strand	93-98	6	18
β-strand	105-106	2	18
β-strand	110-111	2	18
β-strand	112-114	3	17
β-strand	120	1	19
β-strand	123-127	5	20
β-strand	138-148	11	20
β-strand	149	1	19
β-strand	154-157	4	21
α-helix	158-160	3
β-strand	162	1	21
β-strand	166-168	3	20
β-strand	172-174	3	20
β-strand	177-187	11	20
β-strand	197-202	6	21
α-helix	203-205	3
β-strand	207-212	6	21

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Isoform 2 of Potassium channel subfamily K member 4	A, B	protein	299	Homo sapiens	Q9NYG8 (AlphaFold model)
Anti-traak antibody 13E9 FAB fragment light chain	D, F	protein	211	Mus musculus
Anti-traak antibody 13E9 FAB fragment heavy chain	E, G	protein	217	Mus musculus

Sequence of entity 1 (A, B), FASTA

>7LJA_1 Isoform 2 of Potassium channel subfamily K member 4 (chains A, B)
MTTAPQEPPARPLQAGSGAGPAPGRAMRSTTLLALLALVLLYLVSGALVFRALEQPHEQQ
AQRELGEVREKFLRAHPCVSDQELGLLIKEVADALGGGADPETQSTSQSSHSAWDLGSAF
FFSGTIITTIGYGNVALRTDAGRLFCIFYALVGIPLFGILLAGVGDRLGSSLRHGIGHIE
AIFLKWHVPPELVRVLSEMLFLLIGCLLFVLTPTFVFCYMEDWSKLEAIYFVIVTLTTVG
FGDYVAGADPRQDSPAYQPLVWFWILLGLAYFASVLTTIGNWLRVVSRRTSNSLEVLFQ

Sequence of entity 2 (D, F), FASTA

>7LJA_2 ANTI-TRAAK ANTIBODY 13E9 FAB FRAGMENT LIGHT CHAIN (chains D, F)
QIVLTQSPAIMSASPGEKVTMTCSASSSVSYMHWYQQKSGTSPKRWIYDTSKLASGVPAR
FSGSGSGTSYSLTISSMEAEDAATYYCQQWSNSPPTFGAGAKLELKRADAAPTVSIFPPS
SEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTL
TKDEYERHNSYTCEATHKTSTSPIVKSFNRN

Sequence of entity 3 (E, G), FASTA

>7LJA_3 ANTI-TRAAK ANTIBODY 13E9 FAB FRAGMENT HEAVY CHAIN (chains E, G)
EVQLQQSGPELVKPGASMKTSCKVSGYSFTGYIMNWVKQRHGKNLEWIGLINPNTGYTTY
NQKFKGKATLTVDKSSSTAYMELLSLTSEDSAIYYCTRGNYVFDYWGQGTTLTVSSAKTT
PPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTL
SSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	3
TL	Thallium (I) ion	Tl	8

Primary citation

Physical basis for distinct basal and mechanically gated activity of the human K + channel TRAAK. Rietmeijer, R.A., Sorum, B., Li, B. et al. Neuron (2021) 109:2902-2913.e4. DOI 10.1016/j.neuron.2021.07.009 · PubMed

Other PDB entries of the same protein (UniProt Q9NYG8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7LJ5 2.26 Å, Human TRAAK K+ channel FHIEG mutant A198E in a K+ bound conductive conformation
4WFE 2.5 Å, Human TRAAK K+ channel in a K+ bound conductive conformation
4WFF 2.5 Å, Human TRAAK K+ channel in a K+ bound nonconductive conformation
4I9W 2.75 Å, Human two pore domain K+ channel TRAAK (K2P4.1) - Fab complex structure
7LJ4 2.78 Å, Human TRAAK K+ channel FHEIG mutant A270P in a K+ bound conductive conformation
7LJB 2.97 Å, Human TRAAK K+ channel mutant G158D in a K+ bound conductive conformation
4WFG 3.0 Å, Human TRAAK K+ channel in a Tl+ bound conductive conformation
4WFH 3.01 Å, Human TRAAK K+ channel in a Tl+ bound nonconductive conformation
4RUE 3.3 Å, Human K2P4.1 (TRAAK) potassium channel, G124I mutant
3UM7 3.31 Å, Crystal structure of the human two pore domain K+ ion channel TRAAK (K2P4.1)
4RUF 3.4 Å, Human K2P4.1 (TRAAAK) potassium channel, W262S mutant

Browse structure collections

About this viewer

MolViewer shows 7LJA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.