4RUF: Potassium channel subfamily K member 4

Human K2P4.1 (TRAAAK) potassium channel, W262S mutant. Determined by X-ray diffraction at 3.4 Å resolution. Released 17 Dec 2014.

Method: X-ray diffraction
Resolution: 3.4 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,923
Mol. weight: 67.21 kDa
Released: 17 Dec 2014

Explore 4RUF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4RUF contains 22 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	21-27	7
α-helix	29-54	26
α-helix	64-73	10
α-helix	81-95	15
α-helix	116-127	12
α-helix	140-185	46
α-helix	190-192	3
α-helix	199-206	8
α-helix	207-211	5
α-helix	212-220	9
α-helix	225-236	12
α-helix	257-282	26

Chain B: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	29-52	24
α-helix	55-75	21
α-helix	81-96	16
α-helix	116-127	12
α-helix	140-183	44
α-helix	190-206	17
α-helix	207-211	5
α-helix	212-220	9
α-helix	225-236	12
α-helix	257-281	25

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Potassium channel subfamily K member 4	A, B	protein	309	Homo sapiens	Q9NYG8 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4RUF_1 Potassium channel subfamily K member 4 (chains A, B)
MTTAPQEPPARPLQAGSGAGPAPGRAMRSTTLLALLALVLLYLVSGALVFRALEQPHEQQ
AQRELGEVREKFLRAHPCVSDQELGLLIKEVADALGGGADPETQSTSQSSHSAWDLGSAF
FFSGTIITTIGYGNVALRTDAGRLFCIFYALVGIPLFGILLAGVGDRLGSSLRHGIGHIE
AIFLKWHVPPELVRVLSAMLFLLIGCLLFVLTPTFVFCYMEDWSKLEAIYFVIVTLTTVG
FGDYVAGADPRQDSPAYQPLVSFWILLGLAYFASVLTTIGNWLRVVSRRTRAEMGGLTAQ
SNSLEVLFQ

Primary citation

Transmembrane Helix Straightening and Buckling Underlies Activation of Mechanosensitive and Thermosensitive K2P Channels. Lolicato, M., Riegelhaupt, P.M., Arrigoni, C. et al. Neuron (2014) 84:1198-1212. DOI 10.1016/j.neuron.2014.11.017 · PubMed

Other PDB entries of the same protein (UniProt Q9NYG8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7LJ5 2.26 Å, Human TRAAK K+ channel FHIEG mutant A198E in a K+ bound conductive conformation
4WFE 2.5 Å, Human TRAAK K+ channel in a K+ bound conductive conformation
4WFF 2.5 Å, Human TRAAK K+ channel in a K+ bound nonconductive conformation
4I9W 2.75 Å, Human two pore domain K+ channel TRAAK (K2P4.1) - Fab complex structure
7LJA 2.77 Å, Human TRAAK K+ channel FHEIG mutant A198E in a Tl+ bound conductive conformation
7LJ4 2.78 Å, Human TRAAK K+ channel FHEIG mutant A270P in a K+ bound conductive conformation
7LJB 2.97 Å, Human TRAAK K+ channel mutant G158D in a K+ bound conductive conformation
4WFG 3.0 Å, Human TRAAK K+ channel in a Tl+ bound conductive conformation
4WFH 3.01 Å, Human TRAAK K+ channel in a Tl+ bound nonconductive conformation
4RUE 3.3 Å, Human K2P4.1 (TRAAK) potassium channel, G124I mutant
3UM7 3.31 Å, Crystal structure of the human two pore domain K+ ion channel TRAAK (K2P4.1)

Browse structure collections

About this viewer

MolViewer shows 4RUF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.