XFEL structure of the human delta opioid receptor in complex with a bifunctional peptide. Determined by X-ray diffraction at 2.7 Å resolution. Released 14 Jan 2015.
Explore 4RWD in 3D Show helices and sheets RCSB PDB PDBe
4RWD contains 42 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1002-1018 | 17 | |
| α-helix | 1023-1041 | 19 | |
| α-helix | 1046-1048 | 3 | |
| α-helix | 1056-1080 | 25 | |
| α-helix | 1084-1101 | 18 | |
| α-helix | 1103-1105 | 3 | |
| α-helix | 41-42 | 2 | |
| α-helix | 43-76 | 34 | |
| α-helix | 78-80 | 3 | |
| α-helix | 83-100 | 18 | |
| α-helix | 102-111 | 10 | |
| α-helix | 117-151 | 35 | |
| α-helix | 153-159 | 7 | |
| α-helix | 162-186 | 25 | |
| β-strand | 187-192 | 6 | 1 |
| β-strand | 195-200 | 6 | 1 |
| α-helix | 202-203 | 2 | |
| α-helix | 206-218 | 13 | |
| α-helix | 219-223 | 5 | |
| α-helix | 224-241 | 18 | |
| α-helix | 250-286 | 37 | |
| α-helix | 294-321 | 28 | |
| α-helix | 323-332 | 10 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1003-1018 | 16 | |
| α-helix | 1023-1041 | 19 | |
| α-helix | 1046-1048 | 3 | |
| α-helix | 1056-1080 | 25 | |
| α-helix | 1084-1101 | 18 | |
| α-helix | 1103-1105 | 3 | |
| α-helix | 41-42 | 2 | |
| α-helix | 43-76 | 34 | |
| α-helix | 78-80 | 3 | |
| α-helix | 83-100 | 18 | |
| α-helix | 102-111 | 10 | |
| α-helix | 117-151 | 35 | |
| α-helix | 153-159 | 7 | |
| α-helix | 162-186 | 25 | |
| β-strand | 187-192 | 6 | 2 |
| β-strand | 195-200 | 6 | 2 |
| α-helix | 202 | 1 | |
| α-helix | 206-218 | 13 | |
| α-helix | 219-223 | 5 | |
| α-helix | 224-241 | 18 | |
| α-helix | 250-286 | 37 | |
| α-helix | 294-321 | 28 | |
| α-helix | 323-331 | 9 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Soluble cytochrome b562,Delta-type opioid receptor | A, B | protein | 411 | Escherichia coli, Homo sapiens | P0ABE7 (AlphaFold model), P41143 (AlphaFold model) |
| bifunctional peptide | G, H | protein | 5 | synthetic construct |
>4RWD_1 Soluble cytochrome b562,Delta-type opioid receptor (chains A, B) GGTTMADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDS PEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLGARSASSLA LAIAITALYSAVCAVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSA KYLMETWPFGELLCKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKL INICIWVLASGVGVPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPIL IITVCYGLMLLRLRSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLV DIDRRDPLVVAALHLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCG
>4RWD_2 bifunctional peptide (chains G, H) YXFFX
| ID | Name | Formula | Copies |
|---|---|---|---|
| OLA | Oleic acid | C18 H34 O2 | 7 |
| OLC | (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate | C21 H40 O4 | 3 |
Water and common crystallization additives (NA) are not listed.
Structural basis for bifunctional peptide recognition at human delta-opioid receptor. Fenalti, G., Zatsepin, N.A., Betti, C. et al. Nat Struct Mol Biol (2015) 22:265-268. DOI 10.1038/nsmb.2965 · PubMed
Other PDB entries of the same protein (UniProt P0ABE7 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4RWD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.