4RZT: Lac repressor

Name: PDB 4RZT: Lac repressor engineered to bind sucralose, sucralose-bound tetramer
Published: 2015-12-23
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

Lac repressor engineered to bind sucralose, sucralose-bound tetramer. Determined by X-ray diffraction at 3.1 Å resolution. Released 23 Dec 2015.

Method: X-ray diffraction
Resolution: 3.1 Å
Organism: Escherichia coli
Chains: 4
Atoms: 8,787
Mol. weight: 165.12 kDa
Released: 23 Dec 2015

Explore 4RZT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4RZT contains 44 α-helices and 68 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	63-69	7	1
α-helix	74-90	17
β-strand	93-99	7	1
α-helix	103-116	14
β-strand	122-125	4	1
α-helix	130-139	10
β-strand	145-147	3	1
β-strand	158	1	1
β-strand	160-161	2	2
α-helix	163-177	15
β-strand	182-186	5	3
α-helix	192-206	15
β-strand	214-217	4	3
α-helix	222-234	13
β-strand	241-244	4	3
α-helix	247-259	13
β-strand	264	1	4
β-strand	268	1	4
β-strand	269-271	3	3
β-strand	274	1	5
α-helix	277-281	5
β-strand	287	1	3
β-strand	288-290	3	5
α-helix	293-308	16
β-strand	318-319	2	2
β-strand	322-324	3	5
α-helix	339-359	21

Chain B: 12 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	63-69	7	1
α-helix	74-90	17
β-strand	93-99	7	1
α-helix	103-116	14
β-strand	122-125	4	1
α-helix	130-139	10
β-strand	145-147	3	1
β-strand	158	1	1
β-strand	160-161	2	6
α-helix	163-177	15
β-strand	182-186	5	7
α-helix	192-206	15
β-strand	214-217	4	7
α-helix	222-234	13
β-strand	241-244	4	7
α-helix	247-259	13
β-strand	264	1	8
β-strand	268	1	8
β-strand	269-271	3	7
β-strand	274	1	9
α-helix	277-281	5
α-helix	285-286	2
β-strand	287	1	7
β-strand	288-290	3	9
α-helix	293-308	16
β-strand	318-319	2	6
β-strand	322-324	3	9
α-helix	339-352	14
α-helix	353-355	3

Chain C: 11 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	63-69	7	10
α-helix	74-90	17
β-strand	93-99	7	10
α-helix	103-116	14
β-strand	122-125	4	10
α-helix	130-139	10
β-strand	145-147	3	10
β-strand	158	1	10
β-strand	160-161	2	11
α-helix	163-177	15
β-strand	182-186	5	12
α-helix	192-206	15
β-strand	214-217	4	12
α-helix	222-234	13
β-strand	241-244	4	12
α-helix	247-259	13
β-strand	264	1	13
β-strand	268	1	13
β-strand	269-271	3	12
β-strand	274	1	14
α-helix	277-281	5
α-helix	285-286	2
β-strand	287	1	12
β-strand	288-290	3	14
α-helix	293-308	16
β-strand	318-319	2	11
β-strand	322-324	3	14
α-helix	339-359	21

Chain D: 11 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	63-69	7	10
α-helix	74-90	17
β-strand	93-99	7	10
α-helix	103-116	14
β-strand	122-125	4	10
α-helix	130-139	10
β-strand	145-147	3	10
β-strand	158	1	10
β-strand	160-161	2	15
α-helix	163-177	15
β-strand	182-186	5	16
α-helix	192-206	15
β-strand	214-217	4	16
α-helix	222-234	13
β-strand	241-244	4	16
α-helix	247-259	13
β-strand	264	1	17
β-strand	268	1	17
β-strand	269-271	3	16
β-strand	274	1	18
α-helix	277-281	5
α-helix	285-286	2
β-strand	287	1	16
β-strand	288-290	3	18
α-helix	293-308	16
β-strand	318-319	2	15
β-strand	322-324	3	18
α-helix	339-355	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Lac repressor	A, B, C, D	protein	381	Escherichia coli	P03023 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>4RZT_1 Lac repressor (chains A, B, C, D)
MGSSHHHHHHSSGLVPRGSHMVKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVE
AAMAELNYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMV
ERSGVEACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLTASDQTPLNSI
IFSHEDGTRLGVEHLVALGHQQIALLAGPLSSVDARLRLAGWHKYLTRNQIQPIAEREGD
WSAMSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDS
SCYIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASP
RALADSLMQLARQVSRLESGQ

Primary citation

Engineering an allosteric transcription factor to respond to new ligands. Taylor, N.D., Garruss, A.S., Moretti, R. et al. Nat Methods (2016) 13:177-183. DOI 10.1038/nmeth.3696 · PubMed

Other PDB entries of the same protein (UniProt P03023 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8GOH 1.1 Å, Homotetramic Antiparallel Coiled-Coil of 23-residues LacI C-terminal tetramerization helix
1JYE 1.7 Å, Structure of a Dimeric Lac Repressor with C-terminal Deletion and K84L Substitution
2P9H 2.0 Å, High resolution structure of the Lactose Repressor bound to IPTG
3EDC 2.1 Å, Crystal Structure of a 1.6-hexanediol Bound Tetrameric Form of Escherichia coli…
1EFA 2.6 Å, Crystal structure of the lac repressor dimer bound to operator and the anti-inducer onpf
1TLF 2.6 Å, Unprecedented quaternary structure of E. Coli lac repressor core tetramer: implications…
1LBI 2.7 Å, Lac repressor
4RZS 2.71 Å, Lac repressor engineered to bind sucralose, unliganded tetramer
1JYF 3.0 Å, Structure of the Dimeric Lac Repressor with an 11-residue C-terminal Deletion.
1LBH 3.2 Å, Intact lactose operon repressor with gratuitous inducer iptg
2PAF 3.5 Å, Crystal Structure of the Lactose Repressor bound to anti-inducer ONPF in induced state
2PE5 3.5 Å, Crystal Structure of the Lac Repressor bound to ONPG in repressed state

Browse structure collections

About this viewer

MolViewer shows 4RZT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.