The co-complex structure of the translation initiation factor eIF4E with the inhibitor 4EGI-1 reveals an allosteric mechanism for dissociating eIF4G. Determined by X-ray diffraction at 1.59 Å resolution. Released 13 Aug 2014.
Explore 4TQB in 3D Show helices and sheets RCSB PDB PDBe
4TQB contains 22 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 38-49 | 12 | 1 |
| α-helix | 56-59 | 4 | |
| β-strand | 60-68 | 9 | 1 |
| α-helix | 69-78 | 10 | |
| α-helix | 80-81 | 2 | |
| α-helix | 82-84 | 3 | |
| α-helix | 86 | 1 | |
| β-strand | 89-95 | 7 | 1 |
| β-strand | 111-116 | 6 | 1 |
| α-helix | 117-118 | 2 | |
| α-helix | 119-122 | 4 | |
| α-helix | 126-138 | 13 | |
| α-helix | 143-148 | 6 | |
| β-strand | 149-155 | 7 | 1 |
| β-strand | 162-167 | 6 | 1 |
| α-helix | 173-187 | 15 | |
| β-strand | 196-199 | 4 | 1 |
| α-helix | 200-203 | 4 | |
| α-helix | 211-213 | 3 | |
| β-strand | 215-216 | 2 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 38-48 | 11 | 2 |
| α-helix | 56-59 | 4 | |
| β-strand | 60-68 | 9 | 2 |
| α-helix | 69-76 | 8 | |
| α-helix | 82-84 | 3 | |
| α-helix | 86 | 1 | |
| β-strand | 90-95 | 6 | 2 |
| β-strand | 111-116 | 6 | 2 |
| α-helix | 119-124 | 6 | |
| α-helix | 126-138 | 13 | |
| α-helix | 143-148 | 6 | |
| β-strand | 149-155 | 7 | 2 |
| β-strand | 162-167 | 6 | 2 |
| α-helix | 173-186 | 14 | |
| β-strand | 196-199 | 4 | 2 |
| α-helix | 200-204 | 5 | |
| α-helix | 211-213 | 3 | |
| β-strand | 215-216 | 2 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Eukaryotic translation initiation factor 4E | A, B | protein | 191 | Homo sapiens | P06730 (AlphaFold model) |
>4TQB_1 Eukaryotic translation initiation factor 4E (chains A, B) MVANPEHYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLM PGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLDRFWLETLLCLIGESFDDYS DDVCGAVVNVRAKGDKIAIWTTECENREAVTHIGRVYKERLGLPPKIVIGYQSHADTATK SGSTTKNRFVV
| ID | Name | Formula | Copies |
|---|---|---|---|
| 34K | (2E)-2-{2-[4-(4-bromophenyl)-1,3-thiazol-2-yl]hydrazinylidene}-3-(2-nitrophenyl… | C18 H13 Br N4 O4 S | 1 |
| MGT | 7N-methyl-8-hydroguanosine-5'-triphosphate | C11 H20 N5 O14 P3 | 2 |
Water and common crystallization additives (MES) are not listed.
Structure of the eukaryotic translation initiation factor eIF4E in complex with 4EGI-1 reveals an allosteric mechanism for dissociating eIF4G. Papadopoulos, E., Jenni, S., Kabha, E. et al. Proc Natl Acad Sci U S A (2014) 111:E3187-E3195. DOI 10.1073/pnas.1410250111 · PubMed
Other PDB entries of the same protein (UniProt P06730 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4TQB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.