Hexameric HIV-1 CA in complex with DDD00074110. Determined by X-ray diffraction at 1.63 Å resolution. Released 27 Mar 2024.
Explore 8QUB in 3D Show helices and sheets RCSB PDB PDBe
8QUB contains 16 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-4 | 3 | 1 |
| β-strand | 10-12 | 3 | 1 |
| α-helix | 14-16 | 3 | |
| α-helix | 17-30 | 14 | |
| α-helix | 36-43 | 8 | |
| α-helix | 49-57 | 9 | |
| α-helix | 63-83 | 21 | |
| α-helix | 90-92 | 3 | |
| α-helix | 95-100 | 6 | |
| α-helix | 101-104 | 4 | |
| α-helix | 111-119 | 9 | |
| α-helix | 126-145 | 20 | |
| α-helix | 150-152 | 3 | |
| α-helix | 161-175 | 15 | |
| α-helix | 179-184 | 6 | |
| α-helix | 189-192 | 4 | |
| α-helix | 196-203 | 8 | |
| α-helix | 211-217 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Spacer peptide 1 | A | protein | 231 | Human immunodeficiency virus 1 | P12493 |
>8QUB_1 Spacer peptide 1 (chains A) PIVQNLQGQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVG GHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTH NPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQE VKNAATETLLVQNANPDCKTILKALGPGATLEEMMTACQGVGGPGHKARVL
| ID | Name | Formula | Copies |
|---|---|---|---|
| WVZ | (1~{S})-1-phenyl-2,4-dihydro-1~{H}-isoquinolin-3-one | C15 H13 N O | 1 |
Application of an NMR/Crystallography Fragment Screening Platform for the Assessment and Rapid Discovery of New HIV-CA Binding Fragments. Lang, S., Fletcher, D.A., Petit, A.P. et al. ChemMedChem (2024) 19:e202400025-e202400025. DOI 10.1002/cmdc.202400025 · PubMed
Other PDB entries of the same protein (UniProt P12493), best resolution first:
MolViewer shows 8QUB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.