4U4A: Breast cancer type 1 susceptibility protein

Complex Structure of BRCA1 BRCT with singly phospho Abraxas. Determined by X-ray diffraction at 3.51 Å resolution. Released 26 Aug 2015.

Method: X-ray diffraction
Resolution: 3.51 Å
Organism: Homo sapiens
Chains: 6
Atoms: 5,332
Mol. weight: 77.58 kDa
Released: 26 Aug 2015

Explore 4U4A in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4U4A contains 32 α-helices and 33 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	1651-1655	5	1
α-helix	1659-1671	13
β-strand	1684-1689	6	1
β-strand	1696-1697	2	2
α-helix	1701-1709	9
β-strand	1712-1715	4	1
α-helix	1717-1725	9
β-strand	1735	1	1
β-strand	1738-1739	2	2
α-helix	1748-1754	7
β-strand	1764-1768	5	3
α-helix	1777-1785	9
β-strand	1790-1792	3	3
β-strand	1805-1810	6	3
α-helix	1812-1814	3
α-helix	1820-1822	3
α-helix	1824-1827	4
β-strand	1832-1834	3	3
α-helix	1835-1843	9
α-helix	1847-1849	3
α-helix	1850-1853	4
β-strand	1854	1	3

Chain B: 10 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	1651-1655	5	4
α-helix	1659-1671	13
β-strand	1684-1689	6	4
β-strand	1696-1697	2	5
α-helix	1701-1709	9
β-strand	1712-1715	4	4
α-helix	1717-1725	9
β-strand	1735	1	4
β-strand	1738-1739	2	5
α-helix	1748-1754	7
β-strand	1764-1768	5	6
α-helix	1777-1785	9
β-strand	1790-1792	3	6
β-strand	1805-1810	6	6
α-helix	1812-1814	3
α-helix	1820-1822	3
α-helix	1824-1827	4
β-strand	1832-1834	3	6
α-helix	1835-1843	9
α-helix	1850-1853	4
β-strand	1854	1	6

Chain C: 11 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	1652-1655	4	7
α-helix	1659-1671	13
β-strand	1686-1689	4	7
β-strand	1696-1697	2	8
α-helix	1701-1709	9
β-strand	1712-1715	4	7
α-helix	1717-1725	9
β-strand	1735	1	7
β-strand	1738-1739	2	8
α-helix	1748-1754	7
β-strand	1764-1768	5	9
α-helix	1777-1785	9
β-strand	1790-1792	3	9
β-strand	1805-1810	6	9
α-helix	1812-1814	3
α-helix	1820-1822	3
α-helix	1824-1827	4
β-strand	1832-1834	3	9
α-helix	1835-1843	9
α-helix	1847-1849	3
α-helix	1850-1853	4
β-strand	1854	1	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Breast cancer type 1 susceptibility protein	A, B, C	protein	214	Homo sapiens	P38398 (AlphaFold model)
BRCA1-A complex subunit Abraxas	D, E, F	protein	11	Homo sapiens	Q6UWZ7 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>4U4A_1 Breast cancer type 1 susceptibility protein (chains A, B, C)
VNKRMSMVVSGLTPEEFMLVYKFARKHHITLTNLITEETTHVVMKTDAEFVCERTLKYFL
GIAGGKWVVSYFWVTQSIKERKMLNEHDFEVRGDVVNGRNHQGPKRARESQDRKIFRGLE
ICCYGPFTNMPTDQLEWMVQLCGASVVKELSSFTLGTGVHPIVVVQPDAWTEDNGFHAIG
QMCEAPVVTREWVLDSVALYQCQELDTYLIPQIP

Sequence of entity 2 (D, E, F), FASTA

>4U4A_2 BRCA1-A complex subunit Abraxas (chains D, E, F)
GFGEYSRSPTF

Primary citation

Complex Structure of BRCA1 BRCT with singly phospho Abraxas. Badgujar, D., Hosur, M.V., Varma, A.K. To be published.

Other PDB entries of the same protein (UniProt P38398 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8RS8 1.31 Å, Crystal structure of BRCA1 BRCTs in complex with a RIF1 phosphopeptide
4IGK 1.75 Å, Structure of human BRCA1 BRCT in complex with ATRIP peptide
1T15 1.85 Å, Crystal Structure of the Brca1 BRCT Domains in Complex with the Phosphorylated…
4IFI 2.2 Å, Structure of human BRCA1 BRCT in complex with BAAT peptide
1T29 2.3 Å, Crystal structure of the BRCA1 BRCT repeats bound to a phosphorylated BACH1 peptide
1JNX 2.5 Å, Crystal structure of the BRCT repeat region from the breast cancer associated protein,…
1Y98 2.5 Å, Structure of the BRCT repeats of BRCA1 bound to a CtIP phosphopeptide.
3PXB 2.5 Å, Impact of BRCA1 BRCT domain missense substitutions on phospho-peptide recognition: T1700A
4Y2G 2.5 Å, Structure of BRCA1 BRCT domains in complex with Abraxas single phosphorylated peptide
3PXA 2.55 Å, Impact of BRCA1 BRCT domain missense substitutions on phospho-peptide recognition: G1656D
3K0H 2.7 Å, The crystal structure of BRCA1 BRCT in complex with a minimal recognition tetrapeptide…
3K0K 2.7 Å, Crystal Structure of BRCA1 BRCT in complex with a minimal recognition tetrapeptide with…

Browse structure collections

About this viewer

MolViewer shows 4U4A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.