Complex structure of mutant CtCel5E (E314A) with xylobiose. Determined by X-ray diffraction at 2.5 Å resolution. Released 14 Jan 2015.
Explore 4U5I in 3D Show helices and sheets RCSB PDB PDBe
4U5I contains 26 α-helices and 34 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 78-85 | 8 | |
| β-strand | 87-90 | 4 | 1 |
| α-helix | 105-107 | 3 | |
| α-helix | 109-118 | 10 | |
| β-strand | 122-125 | 4 | 1 |
| α-helix | 130-132 | 3 | |
| β-strand | 133 | 1 | 2 |
| α-helix | 140 | 1 | |
| β-strand | 141 | 1 | 2 |
| α-helix | 142 | 1 | |
| α-helix | 143-158 | 16 | |
| β-strand | 162-165 | 4 | 1 |
| α-helix | 172-175 | 4 | |
| α-helix | 177-194 | 18 | |
| β-strand | 202-205 | 4 | 1 |
| β-strand | 212 | 1 | 3 |
| β-strand | 214 | 1 | 3 |
| α-helix | 216-233 | 18 | |
| β-strand | 239-246 | 8 | 1 |
| β-strand | 250-254 | 5 | 1 |
| β-strand | 263-269 | 7 | 1 |
| β-strand | 283 | 1 | 4 |
| α-helix | 286-306 | 21 | |
| β-strand | 310-315 | 6 | 1 |
| β-strand | 320 | 1 | 4 |
| α-helix | 323-339 | 17 | |
| β-strand | 343-346 | 4 | 1 |
| β-strand | 362-363 | 2 | 5 |
| β-strand | 368-369 | 2 | 5 |
| α-helix | 371-377 | 7 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 78-85 | 8 | |
| β-strand | 87-90 | 4 | 1 |
| α-helix | 105-107 | 3 | |
| α-helix | 109-118 | 10 | |
| β-strand | 122-125 | 4 | 1 |
| α-helix | 130-132 | 3 | |
| β-strand | 133 | 1 | 6 |
| α-helix | 140 | 1 | |
| β-strand | 141 | 1 | 6 |
| α-helix | 142 | 1 | |
| α-helix | 143-158 | 16 | |
| β-strand | 162-166 | 5 | 1 |
| α-helix | 172-175 | 4 | |
| α-helix | 177-195 | 19 | |
| β-strand | 202-205 | 4 | 1 |
| β-strand | 212 | 1 | 7 |
| β-strand | 214 | 1 | 7 |
| α-helix | 216-233 | 18 | |
| β-strand | 239-246 | 8 | 1 |
| β-strand | 250-254 | 5 | 1 |
| β-strand | 263-269 | 7 | 1 |
| β-strand | 283 | 1 | 8 |
| α-helix | 286-306 | 21 | |
| β-strand | 310-315 | 6 | 1 |
| β-strand | 320 | 1 | 8 |
| α-helix | 323-339 | 17 | |
| β-strand | 343-346 | 4 | 1 |
| β-strand | 362-363 | 2 | 9 |
| β-strand | 368-369 | 2 | 9 |
| α-helix | 371-377 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Endoglucanase H | A, B | protein | 403 | Clostridium thermocellum ATCC 27405 | P16218 (AlphaFold model) |
>4U5I_1 Endoglucanase H (chains A, B) MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRIEGREFSSPEALAAYREAIGAGSSNPTP TPTWTSTPPSSSPKAVDPFEMVRKMGMGTNLGNTLEAPYEGSWSKSAMEYYFDDFKAAGY KNVRIPVRWDNHTMRTYPYTIDKAFLDRVEQVVDWSLSRGFVTIINSHHDDWIKEDYNGN IERFEKIWEQIAERFKNKSENLLFEIMNEPFGNITDEQIDDMNSRILKIIRKTNPTRIVI IGGGYWNSYNTLVNIKIPDDPYLIGTFHYYDPYEFTHKWRGTWGTQEDMDTVVRVFDFVK SWSDRNNIPVYFGAFAVMAYADRTSRVKWYDFISDAALERGFACSVWDNGVFGSLDNDMA IYNRDTRTFDTEILNALFNPGTYPSYSPKPSPTPRPTKPPVTP
Biochemical Characterization and Structural Analysis of a Bifunctional Cellulase/Xylanase from Clostridium thermocellum. Yuan, S.F., Wu, T.H., Lee, H.L. et al. J Biol Chem (2015) 290:5739-5748. DOI 10.1074/jbc.M114.604454 · PubMed
Other PDB entries of the same protein (UniProt P16218 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4U5I directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.