4UAE: Importin alpha 3 delta IBB

Importin alpha 3 delta IBB in complex with Influenza PB2 Nuclear Localization Domain. Determined by X-ray diffraction at 2.7 Å resolution. Released 4 Feb 2015.

Method: X-ray diffraction
Resolution: 2.7 Å
Organisms: Homo sapiens, Influenza A virus
Chains: 2
Atoms: 4,080
Mol. weight: 55.73 kDa
Released: 4 Feb 2015

Explore 4UAE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4UAE contains 37 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 32 helices, 0 β-strands

Element	Residues	Length
α-helix	73-79	7
α-helix	85-98	14
α-helix	107-112	6
α-helix	115-122	8
α-helix	129-143	15
α-helix	147-154	8
α-helix	159-165	7
α-helix	171-185	15
α-helix	189-197	9
α-helix	201-206	6
α-helix	214-228	15
α-helix	234-236	3
α-helix	237-250	14
α-helix	256-271	16
α-helix	274-283	10
α-helix	286-289	4
α-helix	290-294	5
α-helix	298-311	14
α-helix	316-323	8
α-helix	327-330	4
α-helix	332-335	4
α-helix	340-353	14
α-helix	358-366	9
α-helix	370-379	10
α-helix	382-398	17
α-helix	401-409	9
α-helix	413-417	5
α-helix	418-421	4
α-helix	425-441	17
α-helix	446-455	10
α-helix	458-463	6
α-helix	471-484	14

Chain F: 5 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	687-690	4
α-helix	691-693	3
β-strand	694-699	6	1
α-helix	702-704	3
β-strand	708	1	1
α-helix	710-713	4
β-strand	721-727	7	1
β-strand	730-736	7	1
α-helix	740-744	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Importin subunit alpha-3	A	protein	421	Homo sapiens	O00629 (AlphaFold model)
Polymerase basic protein 2	F	protein	87	Influenza A virus	P31345

Sequence of entity 1 (A), FASTA

>4UAE_1 Importin subunit alpha-3 (chains A)
MVQNTSLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVHCLERD
DNPSLQFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSPHQNVCEQAVWALGNIIG
DGPQCRDYVISLGVVKPLLSFISPSIPITFLRNVTWVMVNLCRHKDPPPPMETIQEILPA
LCVLIHHTDVNILVDTVWALSYLTDAGNEQIQMVIDSGIVPHLVPLLSHQEVKVQTAALR
AVGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFLSNITAGNQQQVQAVID
ANLVPMIIHLLDKGDFGTQKEAAWAISNLTISGRKDQVAYLIQQNVIPPFCNLLTVKDAQ
VVQVVLDGLSNILKMAEDEAETIGNLIEECGGLEKIEQLQNHENEDIYKLAYEIIDQFFS
S

Sequence of entity 2 (F), FASTA

>4UAE_2 Polymerase basic protein 2 (chains F)
GPLGSDPDESTSGVESAVLRGFLILGKEDRRYGPALSINELSNLAKGEKANVLIGQGDVV
LVMKRKRDSSILTDSQTATKRIRMAIN

Primary citation

Molecular Determinants for Nuclear Import of Influenza A PB2 by Importin alpha Isoforms 3 and 7. Pumroy, R.A., Ke, S., Hart, D.J. et al. Structure (2015) 23:374-384. DOI 10.1016/j.str.2014.11.015 · PubMed

Other PDB entries of the same protein (UniProt O00629 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6BW9 1.6 Å, Hendra virus W protein C-terminus in complex with Importin alpha 3 crystal form 1
8HKW 1.9 Å, Crystal structure of importin-alpha3 bound to the 53BP1 nuclear localization signal
7LFC 2.1 Å, Structure of importin a3 bound to p50 NLS
7RG5 2.15 Å, Importin alpha3 in complex with p50 NLS
6BWA 2.2 Å, Hendra virus W protein C-terminus in complex with Importin alpha 3 crystal form 2
6BVV 2.3 Å, Nipah virus W protein C-terminus in complex with Importin alpha 3
6BVZ 2.3 Å, Importin alpha 3 in cargo free state
6BWB 2.3 Å, Hendra virus W protein C-terminus in complex with Importin alpha 3 crystal form 3
6WX8 2.3 Å, SOX2 bound to Importin-alpha 3
7RFY 2.5 Å, Importin alpha3 in complex with MERS ORF4B
7JJL 2.6 Å, Crystal structure of Importin Alpha 3 in complex with human LSD1 NLS
8FUB 2.75 Å, Crystal structure of human Importin alpha 3 in complex with Hendra virus matrix protein…

Browse structure collections

About this viewer

MolViewer shows 4UAE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.