4UJ3: Human Rab11-Rabin8-FIP3
Crystal structure of human Rab11-Rabin8-FIP3. Determined by X-ray diffraction at 3.0 Å resolution. Released 12 Aug 2015.
- Method
- X-ray diffraction
- Resolution
- 3.0 Å
- Organism
- HOMO SAPIENS
- Chains
- 24
- Atoms
- 23,374
- Mol. weight
- 409.49 kDa
- Ligands
- MG, GNP
- Released
- 12 Aug 2015
Explore 4UJ3 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
4UJ3 contains 130 α-helices and 106 β-strands across 24 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 7 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 10-18 | 9 | 1 |
| α-helix | 24-33 | 10 | |
| α-helix | 42-44 | 3 | |
| β-strand | 46-55 | 10 | 1 |
| β-strand | 58-67 | 10 | 1 |
| α-helix | 77-81 | 5 | |
| β-strand | 84-92 | 9 | 1 |
| α-helix | 96-100 | 5 | |
| α-helix | 102-112 | 11 | |
| β-strand | 118-124 | 7 | 1 |
| α-helix | 136-145 | 10 | |
| β-strand | 149-152 | 4 | 1 |
| α-helix | 161-178 | 18 | |
Chain B: 7 helices, 7 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 293-295 | 3 | 2 |
| α-helix | 299-310 | 12 | |
| α-helix | 319-324 | 6 | |
| α-helix | 325-329 | 5 | |
| α-helix | 330-332 | 3 | |
| α-helix | 338-349 | 12 | |
| β-strand | 354-357 | 4 | 3 |
| β-strand | 375 | 1 | 4 |
| β-strand | 378 | 1 | 4 |
| β-strand | 390-393 | 4 | 3 |
| β-strand | 400-403 | 4 | 3 |
| α-helix | 405-425 | 21 | |
| α-helix | 434-452 | 19 | |
| β-strand | 455 | 1 | 5 |
Chain C: 2 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| α-helix | 721-748 | 28 | |
| α-helix | 750-753 | 4 | |
| β-strand | 754 | 1 | 1 |
Chain D: 7 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 10-18 | 9 | 6 |
| α-helix | 24-33 | 10 | |
| α-helix | 42-44 | 3 | |
| β-strand | 46-55 | 10 | 6 |
| β-strand | 58-67 | 10 | 6 |
| α-helix | 77-81 | 5 | |
| β-strand | 86-92 | 7 | 6 |
| α-helix | 96-100 | 5 | |
| α-helix | 102-112 | 11 | |
| β-strand | 118-124 | 7 | 6 |
| α-helix | 136-145 | 10 | |
| β-strand | 149-153 | 5 | 6 |
| α-helix | 161-179 | 19 | |
Chain E: 7 helices, 7 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 292-295 | 4 | 7 |
| α-helix | 299-310 | 12 | |
| α-helix | 319-324 | 6 | |
| α-helix | 325-329 | 5 | |
| α-helix | 330-332 | 3 | |
| α-helix | 338-349 | 12 | |
| β-strand | 354-357 | 4 | 8 |
| β-strand | 375 | 1 | 9 |
| β-strand | 378 | 1 | 9 |
| β-strand | 390-393 | 4 | 8 |
| β-strand | 400-403 | 4 | 8 |
| α-helix | 405-425 | 21 | |
| α-helix | 434-452 | 19 | |
| β-strand | 455-459 | 5 | 10 |
Chain F: 2 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| α-helix | 723-748 | 26 | |
| α-helix | 750-753 | 4 | |
| β-strand | 754 | 1 | 6 |
Chain G: 7 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 10-18 | 9 | 11 |
| α-helix | 24-33 | 10 | |
| α-helix | 42-44 | 3 | |
| β-strand | 46-55 | 10 | 11 |
| β-strand | 58-67 | 10 | 11 |
| α-helix | 77-81 | 5 | |
| β-strand | 86-92 | 7 | 11 |
| α-helix | 96-100 | 5 | |
| α-helix | 102-112 | 11 | |
| β-strand | 118-124 | 7 | 11 |
| α-helix | 136-145 | 10 | |
| β-strand | 149-153 | 5 | 11 |
| α-helix | 161-178 | 18 | |
Chain H: 7 helices, 7 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 295 | 1 | 5 |
| α-helix | 299-310 | 12 | |
| α-helix | 319-324 | 6 | |
| α-helix | 325-329 | 5 | |
| α-helix | 330-332 | 3 | |
| α-helix | 338-350 | 13 | |
| β-strand | 354-357 | 4 | 12 |
| β-strand | 375 | 1 | 13 |
| β-strand | 378 | 1 | 13 |
| β-strand | 390-393 | 4 | 12 |
| β-strand | 400-403 | 4 | 12 |
| α-helix | 405-425 | 21 | |
| α-helix | 434-453 | 20 | |
| β-strand | 455-457 | 3 | 2 |
13 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Ras-related protein rab-11A | A, D, G, J, M, P, S, V | protein | 187 | HOMO SAPIENS | P62491 (AlphaFold model) |
| Rab-3A-interacting protein | B, E, H, K, N, Q, T, W | protein | 195 | HOMO SAPIENS | Q96QF0 (AlphaFold model) |
| RAB11 family-interacting protein 3 | C, F, I, L, O, R, U, X | protein | 66 | HOMO SAPIENS | O75154 (AlphaFold model) |
Sequence of entity 1 (A, D, G, J, M, P, S, V), FASTA
>4UJ3_1 RAS-RELATED PROTEIN RAB-11A (chains A, D, G, J, M, P, S, V)
GAASRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKT
IKAQIWDTAGLERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVI
MLVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIYRIVSQK
QMSDRRE
Sequence of entity 2 (B, E, H, K, N, Q, T, W), FASTA
>4UJ3_2 RAB-3A-INTERACTING PROTEIN (chains B, E, H, K, N, Q, T, W)
GAASNKSTSSAMSGSHQDLSVIQPIVKDCKEADLSLYNEFRLWKDEPTMDRTCPFLDKIY
QEDIFPCLTFSKSELASAVLEAVENNTLSIEPVGLQPIRFVKASAVECGGPKKCALTGQS
KSCKHRIKLGDSSNYYYISPFCRYRITSVCNFFTYIRYIQQGLVKQQDVDQMFWEVMQLR
KEMSLAKLGYFKEEL
Sequence of entity 3 (C, F, I, L, O, R, U, X), FASTA
>4UJ3_3 RAB11 FAMILY-INTERACTING PROTEIN 3 (chains C, F, I, L, O, R, U, X)
GAASGAKSLFSTAFSESLAAEISSVSRDELMEAIQKQEEINFRLQDYIDRIIVAIMETNP
SILEVK
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| MG | Magnesium ion | Mg | 8 |
| GNP | Phosphoaminophosphonic acid-guanylate ester | C10 H17 N6 O13 P3 | 8 |
Water and common crystallization additives (PG4, SO4) are not listed.
Primary citation
Structure of Rab11-Fip3-Rabin8 Reveals Simultaneous Binding of Fip3 and Rabin8 Effectors to Rab11. Vetter, M., Stehle, R., Basquin, C. et al. Nat Struct Mol Biol (2015) 22:695. DOI 10.1038/NSMB.3065 · PubMed
Other PDB entries of the same protein (UniProt P62491 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 1OIX 1.7 Å, X-ray structure of the small G protein Rab11a in complex with GDP and Pi
- 2D7C 1.75 Å, Crystal structure of human Rab11 in complex with FIP3 Rab-binding domain
- 2HV8 1.86 Å, Crystal structure of GTP-bound Rab11 in complex with FIP3
- 1OIV 1.98 Å, X-ray structure of the small G protein Rab11a in complex with GDP
- 1YZK 2.0 Å, GppNHp bound Rab11 GTPase
- 4C4P 2.0 Å, Crystal Structure of Wild-Type Rab11 Complexed to FIP2
- 1OIW 2.05 Å, X-ray structure of the small G protein Rab11a in complex with GTPgammaS
- 5JCZ 2.06 Å, Rab11 bound to MyoVa-GTD
- 6IY1 2.11 Å, Structure of human Ras-related protein Rab11
- 4LX0 2.19 Å, Crystal structure of Myo5b globular tail domain in complex with active Rab11a
- 5EZ5 2.4 Å, Crystal structure of active Rab11A (S20V) in complex with GTP
- 2GZD 2.44 Å, Crystal Structure of Rab11 in Complex with Rab11-FIP2
Browse structure collections
About this viewer
MolViewer shows 4UJ3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.