4UJ5: Human Rab11-Rabin8-FIP3

Crystal structure of human Rab11-Rabin8-FIP3. Determined by X-ray diffraction at 2.6 Å resolution. Released 12 Aug 2015.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: HOMO SAPIENS
Chains: 4
Atoms: 5,362
Mol. weight: 87.31 kDa
Ligands: MG, GNP
Released: 12 Aug 2015

Explore 4UJ5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4UJ5 contains 28 α-helices and 21 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	10-18	9	1
α-helix	24-32	9
α-helix	42-44	3
β-strand	46-55	10	1
β-strand	58-67	10	1
α-helix	77-81	5
β-strand	86-92	7	1
α-helix	96-100	5
α-helix	102-111	10
β-strand	118-124	7	1
α-helix	136-145	10
β-strand	149-152	4	1
α-helix	161-177	17

Chain B: 7 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	10-17	8	2
α-helix	24-32	9
α-helix	42-44	3
β-strand	46-55	10	2
β-strand	58-67	10	2
α-helix	75-77	3
β-strand	86-92	7	2
α-helix	96-100	5
α-helix	102-111	10
β-strand	118-124	7	2
α-helix	136-145	10
β-strand	149-152	4	2
α-helix	161-174	14

Chain C: 7 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	299-309	11
α-helix	319-324	6
α-helix	325-329	5
α-helix	330-332	3
α-helix	338-349	12
β-strand	354-357	4	3
β-strand	375	1	4
β-strand	378	1	4
β-strand	385	1	4
β-strand	390-393	4	3
β-strand	400-403	4	3
α-helix	405-425	21
α-helix	434-452	19

Chain D: 7 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	299-309	11
α-helix	319-324	6
α-helix	325-329	5
α-helix	330-332	3
α-helix	338-349	12
β-strand	354-357	4	5
β-strand	390-393	4	5
β-strand	400-403	4	5
α-helix	405-425	21
α-helix	434-452	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ras-related protein rab-11A	A, B	protein	185	HOMO SAPIENS	P62491 (AlphaFold model)
Rab-3A-interacting protein	C, D	protein	195	HOMO SAPIENS	Q96QF0 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4UJ5_1 RAS-RELATED PROTEIN RAB-11A (chains A, B)
GAASDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIK
AQIWDTAGLERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIML
VGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIYRIVSQKQM
SDRRE

Sequence of entity 2 (C, D), FASTA

>4UJ5_2 RAB-3A-INTERACTING PROTEIN (chains C, D)
GAASNKSTSSAMSGSHQDLSVIQPIVKDCKEADLSLYNEFRLWKDEPTMDRTCPFLDKIY
QEDIFPCLTFSKSELASAVLEAVENNTLSIEPVGLQPIRFVKASAVECGGPKKCALTGQS
KSCKHRIKLGDSSNYYYISPFCRYRITSVCNFFTYIRYIQQGLVKQQDVDQMFWEVMQLR
KEMSLAKLGYFKEEL

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	2
GNP	Phosphoaminophosphonic acid-guanylate ester	C10 H17 N6 O13 P3	2

Water and common crystallization additives (SO4) are not listed.

Primary citation

Structure of Rab11-Fip3-Rabin8 Reveals Simultaneous Binding of Fip3 and Rabin8 Effectors to Rab11. Vetter, M., Stehle, R., Basquin, C. et al. Nat Struct Mol Biol (2015) 22:695. DOI 10.1038/NSMB.3065 · PubMed

Other PDB entries of the same protein (UniProt P62491 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1OIX 1.7 Å, X-ray structure of the small G protein Rab11a in complex with GDP and Pi
2D7C 1.75 Å, Crystal structure of human Rab11 in complex with FIP3 Rab-binding domain
2HV8 1.86 Å, Crystal structure of GTP-bound Rab11 in complex with FIP3
1OIV 1.98 Å, X-ray structure of the small G protein Rab11a in complex with GDP
1YZK 2.0 Å, GppNHp bound Rab11 GTPase
4C4P 2.0 Å, Crystal Structure of Wild-Type Rab11 Complexed to FIP2
1OIW 2.05 Å, X-ray structure of the small G protein Rab11a in complex with GTPgammaS
5JCZ 2.06 Å, Rab11 bound to MyoVa-GTD
6IY1 2.11 Å, Structure of human Ras-related protein Rab11
4LX0 2.19 Å, Crystal structure of Myo5b globular tail domain in complex with active Rab11a
5EZ5 2.4 Å, Crystal structure of active Rab11A (S20V) in complex with GTP
2GZD 2.44 Å, Crystal Structure of Rab11 in Complex with Rab11-FIP2

Browse structure collections

About this viewer

MolViewer shows 4UJ5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.