Discovery of (2S)-8-((3R)-3-Methylmorpholin-4-yl)-1-(3-methyl-2-oxo- butyl)-2-(trifluoromethyl)-3,4-dihydro-2H-pyrimido(1,2-a)pyrimidin-6- one: a Novel Potent and Selective Inhibitor of Vps34 for the Treatment of Solid Tumors. Determined by X-ray diffraction at 2.7 Å resolution. Released 26 Nov 2014.
Explore 4UWG in 3D Show helices and sheets RCSB PDB PDBe
4UWG contains 33 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 290-300 | 11 | |
| α-helix | 307-309 | 3 | |
| α-helix | 310-318 | 9 | |
| α-helix | 323-325 | 3 | |
| α-helix | 330-334 | 5 | |
| α-helix | 342-354 | 13 | |
| α-helix | 356-359 | 4 | |
| α-helix | 360-363 | 4 | |
| α-helix | 365-367 | 3 | |
| α-helix | 374-384 | 11 | |
| α-helix | 389-401 | 13 | |
| α-helix | 402-405 | 4 | |
| α-helix | 408-412 | 5 | |
| α-helix | 442-444 | 3 | |
| α-helix | 475-483 | 9 | |
| α-helix | 487-502 | 16 | |
| α-helix | 504-509 | 6 | |
| α-helix | 511-529 | 19 | |
| α-helix | 533-561 | 29 | |
| α-helix | 566-578 | 13 | |
| α-helix | 580-583 | 4 | |
| β-strand | 591-593 | 3 | 1 |
| β-strand | 596-604 | 9 | 1 |
| β-strand | 610-611 | 2 | 1 |
| β-strand | 619-625 | 7 | 1 |
| β-strand | 630-637 | 8 | 1 |
| α-helix | 642-660 | 19 | |
| β-strand | 672-674 | 3 | 1 |
| β-strand | 679-683 | 5 | 1 |
| β-strand | 688-689 | 2 | 2 |
| α-helix | 690-697 | 8 | |
| α-helix | 700-707 | 8 | |
| β-strand | 709 | 1 | 3 |
| α-helix | 714-716 | 3 | |
| β-strand | 717 | 1 | 3 |
| α-helix | 719-739 | 21 | |
| α-helix | 746-748 | 3 | |
| β-strand | 749-751 | 3 | 2 |
| β-strand | 757-759 | 3 | 2 |
| α-helix | 781-787 | 7 | |
| α-helix | 793-811 | 19 | |
| α-helix | 813-821 | 9 | |
| α-helix | 829-832 | 4 | |
| α-helix | 835-845 | 11 | |
| α-helix | 852-868 | 17 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Phosphatidylinositol 3-kinase catalytic subunit type 3 | A | protein | 601 | HOMO SAPIENS | Q8NEB9 (AlphaFold model) |
>4UWG_1 PHOSPHATIDYLINOSITOL 3-KINASE CATALYTIC SUBUNIT TYPE 3 (chains A) GAMSDHDLKPNAATRDQLNIIVSYPPTKQLTYEEQDLVWKFRYYLTNQEKALTKFLKCVN WDLPQEAKQALELLGKWKPMDVEDSLELLSSHYTNPTVRRYAVARLRQADDEDLLMYLLQ LVQALKYENFDDIKNGLEPTKKDSQSSVSENVSNSGINSAEIDSSQIITSPLPSVSSPPP ASKTKEVPDGENLEQDLCTFLISRACKNSTLANYLYWYVIVECEDQDTQQRDPKTHEMYL NVMRRFSQALLKGDKSVRVMRSLLAAQQTFVDRLVHLMKAVQRESGNRKKKNERLQALLG DNEKMNLSDVELIPLPLEPQVKIRGIIPETATLFKSALMPAQLFFKTEDGGKYPVIFKHG DDLRQDQLILQIISLMDKLLRKENLDLKLTPYKVLATSTKHGFMQFIQSVPVAEVLDTEG SIQNFFRKYAPSENGPNGISAEVMDTYVKSCAGYCVITYILGVGDRHLDNLLLTKTGKLF HIDFGYILGRDPKPLPPPMKLNKEMVEGMGGTQSEQYQEFRKQCYTAFLHLRRYSNLILN LFSLMVDANIPDIALEPDKTVKKVQDKFRLDLSDEEAVHYMQSLIDESVHALFAAVVEQI H
| ID | Name | Formula | Copies |
|---|---|---|---|
| RBQ | (8S)-2-(morpholin-4-yl)-9-[2-(propan-2-yloxy)ethyl]-8-(trifluoromethyl)-6,7,8,9… | C17 H25 F3 N4 O3 | 1 |
Water and common crystallization additives (SO4) are not listed.
Discovery of (2S)-8-[(3R)-3-Methylmorpholin-4-Yl]-1-(3-Methyl-2-Oxobutyl)-2-(Trifluoromethyl)-3,4-Dihydro-2H-Pyrimido[1,2-A]Pyrimidin-6-One: A Novel Potent and Selective Inhibitor of Vps34 for the Treatment of Solid Tumors. Pasquier, B., El-Ahmad, Y., Filoche-Romme, B. et al. J Med Chem (2015) 58:376. DOI 10.1021/JM5013352 · PubMed
Other PDB entries of the same protein (UniProt Q8NEB9 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4UWG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.