Shotgun proteolysis: A practical application. Determined by solution NMR. Released 17 Sept 2014.
Explore 4UZM in 3D Show helices and sheets RCSB PDB PDBe
4UZM contains 5 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 41-44 | 4 | 1 |
| α-helix | 45-46 | 2 | |
| α-helix | 47-62 | 16 | |
| α-helix | 79-81 | 3 | |
| α-helix | 83-86 | 4 | |
| β-strand | 87-93 | 7 | 1 |
| α-helix | 94 | 1 | |
| β-strand | 95-98 | 4 | 2 |
| β-strand | 109-112 | 4 | 2 |
| β-strand | 115-117 | 3 | 2 |
| β-strand | 118 | 1 | 1 |
| β-strand | 131-137 | 7 | 1 |
| β-strand | 142-147 | 6 | 1 |
| β-strand | 150-151 | 2 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Putative membrane protein igaa homolog | A | protein | 120 | ESCHERICHIA COLI | P45800 (AlphaFold model) |
>4UZM_1 PUTATIVE MEMBRANE PROTEIN IGAA HOMOLOG (chains A) MAFADAQTRKLTPEERSAVENYLESLTQVLQVPGPTGASAAPISLALNAESNNVMMLTHA ITRYGISTDDPNKWRYYLDSVEVHLPPFWEQYINDENTVELIHTDSLPLVISLNGHTLQE
Solution Structure of a Soluble Fragment Derived from a Membrane Protein by Shotgun Proteolysis. Allen, M.D., Christie, M., Jones, P. et al. Protein Eng Des Sel (2015) 28:445. DOI 10.1093/PROTEIN/GZV021 · PubMed
Other PDB entries of the same protein (UniProt P45800 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4UZM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.