9BIY: Periplasmic domain of IgaA from Escherichia coli

Crystal structure of the periplasmic domain of IgaA from Escherichia coli. Determined by X-ray diffraction at 1.8 Å resolution. Released 17 Jul 2024.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Escherichia coli
Chains: 2
Atoms: 2,868
Mol. weight: 39.23 kDa
Released: 17 Jul 2024

Explore 9BIY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9BIY contains 15 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	376-379	4	1
α-helix	382-386	5
β-strand	395-405	11	1
β-strand	424-430	7	1
α-helix	437-439	3
α-helix	442-458	17
α-helix	470-479	10
β-strand	482-484	3	2
α-helix	487-497	11
α-helix	505-514	10
α-helix	520-529	10
β-strand	536	1	3
β-strand	537-539	3	2
α-helix	541-569	29
α-helix	573-574	2
β-strand	578-582	5	1
α-helix	592-594	3
α-helix	598-600	3
α-helix	603-617	15
β-strand	620-633	14	1
β-strand	639-644	6	1

Chain B: 3 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	50-52	3	3
α-helix	55-58	4
β-strand	63-75	13	3
α-helix	81-83	3
α-helix	85-98	14
β-strand	103-108	6	3
β-strand	111-112	2	3
β-strand	120-131	12	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Intracellular growth attenuator protein igaA	A	protein	275	Escherichia coli	P45800 (AlphaFold model)
Outer membrane lipoprotein RcsF	B	protein	88	Escherichia coli	P69411 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9BIY_1 Intracellular growth attenuator protein igaA (chains A)
SAQTIEATSVKQLADAGVRVGDTLRISGTGMCNIRTSGTWSAKTNSPFLPFDCSQIIWND
ARSLPLPESELVNKATALTEAVNRQLHPKPEDESRVSASLRSAIQKSGMVLLDDFGDIVL
KTADLCSAKDDCVRLKNALVNLGNSKDWDALVKRANAGKLDGVNVLLRPVSAESLDNLVA
TSTAPFITHETARAAQSLNSPAPGGFLIVSDEGSDFVDQPWPSASLYDYPPQEQWNAFQK
LAQMLMHTPFNAEGIVTKIFTDANGTQHIGLHPIP

Sequence of entity 2 (B), FASTA

>9BIY_2 Outer membrane lipoprotein RcsF (chains B)
RATPVRIYTNAEELVGKPFRDLGEVSGDSCQASNQDSPPSIPTARKRMQINASKMKANAV
LLHSCEVTSGTPGCYRQAVCIGSALNIT

Primary citation

Molecular insights into the initiation step of the Rcs signaling pathway. Watanabe, N., Savchenko, A. Structure (2024) 32:1381-1393.e4. DOI 10.1016/j.str.2024.06.003 · PubMed

Other PDB entries of the same protein (UniProt P45800 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9BJ0 2.64 Å, Crystal structure of the periplasmic domain of IgaA from Escherichia coli
4UZM Shotgun proteolysis: A practical application

Browse structure collections

About this viewer

MolViewer shows 9BIY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.