Crystal structure of the periplasmic domain of IgaA from Escherichia coli. Determined by X-ray diffraction at 2.64 Å resolution. Released 17 Jul 2024.
Explore 9BJ0 in 3D Show helices and sheets RCSB PDB PDBe
9BJ0 contains 28 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 376-379 | 4 | 1 |
| α-helix | 382-388 | 7 | |
| β-strand | 395-406 | 12 | 1 |
| β-strand | 423-430 | 8 | 1 |
| α-helix | 434-439 | 6 | |
| α-helix | 442-458 | 17 | |
| α-helix | 470-478 | 9 | |
| β-strand | 482-484 | 3 | 2 |
| α-helix | 487-497 | 11 | |
| α-helix | 505-513 | 9 | |
| α-helix | 520-529 | 10 | |
| β-strand | 537-539 | 3 | 2 |
| α-helix | 541-569 | 29 | |
| α-helix | 573-574 | 2 | |
| β-strand | 578-582 | 5 | 1 |
| α-helix | 591-594 | 4 | |
| α-helix | 598-600 | 3 | |
| α-helix | 603-605 | 3 | |
| α-helix | 606-617 | 12 | |
| β-strand | 620-633 | 14 | 1 |
| α-helix | 638 | 1 | |
| β-strand | 639-644 | 6 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 376-379 | 4 | 3 |
| α-helix | 382-386 | 5 | |
| β-strand | 395-402 | 8 | 3 |
| β-strand | 403-406 | 4 | 4 |
| β-strand | 423-430 | 8 | 4 |
| α-helix | 436-439 | 4 | |
| α-helix | 442-458 | 17 | |
| α-helix | 470-478 | 9 | |
| β-strand | 482-484 | 3 | 5 |
| α-helix | 487-495 | 9 | |
| α-helix | 505-515 | 11 | |
| α-helix | 520-528 | 9 | |
| β-strand | 537-539 | 3 | 5 |
| α-helix | 541-569 | 29 | |
| α-helix | 573-574 | 2 | |
| β-strand | 578-582 | 5 | 4 |
| α-helix | 591-594 | 4 | |
| α-helix | 598-600 | 3 | |
| α-helix | 603-605 | 3 | |
| α-helix | 606-617 | 12 | |
| β-strand | 620-627 | 8 | 3 |
| β-strand | 631-633 | 3 | 4 |
| α-helix | 638 | 1 | |
| β-strand | 639-643 | 5 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Intracellular growth attenuator protein igaA | A, B | protein | 274 | Escherichia coli | P45800 (AlphaFold model) |
>9BJ0_1 Intracellular growth attenuator protein igaA (chains A, B) SAQTIEATSVKQLADAGVRVGDTLRISGTGMCNIRTSGTWSAKTNSPFLPFDCSQIIWND ARSLPLPESELVNKATALTEAVNRQLHPKPEDESRVSASLRSAIQKSGMVLLDDFGDIVL KTADLCSAKDDCVRLKNALVNLGNSKDWDALVKRANAGKLDGVNVLLRPVSAESLDNLVA TSTAPFITHETARAAQSLNSPAPGGFLIVSDEGSDFVDQPWPSASLYDYPPQEQWNAFQK LAQMLMHTPFNAEGIVTKIFTDANGTQHIGLHPI
Molecular insights into the initiation step of the Rcs signaling pathway. Watanabe, N., Savchenko, A. Structure (2024) 32:1381-1393.e4. DOI 10.1016/j.str.2024.06.003 · PubMed
Other PDB entries of the same protein (UniProt P45800 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9BJ0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.