4V1P: BTN3 Structure

BTN3 Structure. Determined by X-ray diffraction at 2.04 Å resolution. Released 22 Jul 2015.

Method: X-ray diffraction
Resolution: 2.04 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 1,650
Mol. weight: 21.7 kDa
Released: 22 Jul 2015

Explore 4V1P in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4V1P contains 4 α-helices and 17 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	21-29	9
β-strand	31-32	2	1
α-helix	33	1
β-strand	37	1	2
α-helix	39-41	3
β-strand	46-48	3	1
β-strand	54-57	4	1
β-strand	76-78	3	3
β-strand	79	1	2
β-strand	83	1	3
β-strand	87-93	7	1
β-strand	100-106	7	3
α-helix	119-121	3
β-strand	123-129	7	3
β-strand	133-136	4	3
β-strand	142-144	3	3
β-strand	152-158	7	1
β-strand	163-168	6	1
β-strand	174-178	5	1
β-strand	187-192	6	3
β-strand	201-204	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Butyrophilin subfamily 3 member A1	A	protein	188	HOMO SAPIENS	O00481 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4V1P_1 BUTYROPHILIN SUBFAMILY 3 MEMBER A1 (chains A)
RHSAYNEWKKALFKPADVILDPKTANPILLVSEDQRSVQRAKEPQDLPDNPERFNWHYCV
LGCESFISGRHYWEVEVGDRKEWHIGVCSKNVQRKGWVKMTPENGFWTMGLTDGNKYRTL
TEPRTNLKLPKPPKKVGVFLDYETGDISFYNAVDGSHIHTFLDVSFSEALYPVFRILTLE
PTALSICP

Primary citation

Activation of Human Gammadelta T Cells by Cytosolic Interactions of Btn3A1 with Soluble Phosphoantigens and the Cytoskeletal Adaptor Periplakin. Rhodes, D.A., Chen, H., Price, A.J. et al. J Immunol (2015) 194:2390. DOI 10.4049/JIMMUNOL.1401064 · PubMed

Other PDB entries of the same protein (UniProt O00481 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6ITA 1.2 Å, Crystal structure of intracellular B30.2 domain of BTN3A1 mutant
6ISM 1.25 Å, Crystal structure of intracellular B30.2 domain of BTN3A1 mutant
8IZE 1.4 Å, Crystal structure of intracellular B30.2 domain of BTN3A1 in complex with 4-HMBPP
4N7I 1.4 Å, Crystal Structure of Intracellular B30.2 Domain of BTN3A1
4N7U 1.46 Å, Crystal Structure of Intracellular B30.2 Domain of BTN3A1 in Complex with CHDMAPP
5LYG 1.6 Å, Crystal structure of intracellular B30.2 domain of BTN3A1 bound to malonate
8IZG 1.6 Å, Crystal structure of intracellular B30.2 domain of BTN3A1 in complex with 5-HMBPP
5LYK 1.7 Å, Crystal structure of intracellular B30.2 domain of BTN3A1 bound to citrate
8IXV 1.72 Å, Crystal structure of intracellular B30.2 domain of BTN3A in complex with 2Cl-HMBPP
4K55 1.91 Å, Structure of the extracellular domain of butyrophilin BTN3A1 in complex with…
5HM7 1.93 Å, The Intracellular domain of Butyrophilin 3A1 protein
4F80 1.94 Å, Crystal Structure of the human BTN3A1 ectodomain

Browse structure collections

About this viewer

MolViewer shows 4V1P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.