Structure of MST3 with a pyrrolopyrimidine inhibitor (PF-06645342). Determined by X-ray diffraction at 1.79 Å resolution. Released 18 Mar 2015.
Explore 4W8E in 3D Show helices and sheets RCSB PDB PDBe
4W8E contains 18 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 17-18 | 2 | 1 |
| α-helix | 20-22 | 3 | |
| β-strand | 24-32 | 9 | 1 |
| β-strand | 37-43 | 7 | 1 |
| β-strand | 49-56 | 8 | 1 |
| α-helix | 64-76 | 13 | |
| β-strand | 82 | 1 | 2 |
| β-strand | 85-91 | 7 | 1 |
| β-strand | 94-100 | 7 | 1 |
| β-strand | 105-106 | 2 | 2 |
| α-helix | 107-111 | 5 | |
| α-helix | 115-117 | 3 | |
| α-helix | 118-137 | 20 | |
| β-strand | 140-141 | 2 | 3 |
| α-helix | 147-149 | 3 | |
| β-strand | 150-152 | 3 | 2 |
| β-strand | 158-160 | 3 | 2 |
| β-strand | 167-168 | 2 | 3 |
| β-strand | 176 | 1 | 4 |
| α-helix | 183-185 | 3 | |
| α-helix | 188-191 | 4 | |
| β-strand | 196 | 1 | 4 |
| α-helix | 199-214 | 16 | |
| α-helix | 224-233 | 10 | |
| α-helix | 235-237 | 3 | |
| α-helix | 245-254 | 10 | |
| α-helix | 259-261 | 3 | |
| α-helix | 263-264 | 2 | |
| α-helix | 265-268 | 4 | |
| α-helix | 272-277 | 6 | |
| α-helix | 281-284 | 4 | |
| α-helix | 285-297 | 13 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Serine/threonine-protein kinase 24 36 kDa subunit | A | protein | 291 | Homo sapiens | Q9Y6E0 (AlphaFold model) |
>4W8E_1 Serine/threonine-protein kinase 24 36 kDa subunit (chains A) GLPGMQNLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQ QEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREI LKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMAP EVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLK EFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAEQS
| ID | Name | Formula | Copies |
|---|---|---|---|
| 3JB | 3-{4-[(2R)-2-(5-methyl-1,2,4-oxadiazol-3-yl)morpholin-4-yl]-7H-pyrrolo[2,3-d]py… | C20 H17 N7 O2 | 1 |
Discovery and preclinical profiling of 3-[4-(morpholin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-5-yl]benzonitrile (PF-06447475), a highly potent, selective, brain penetrant, and in vivo active LRRK2 kinase inhibitor. Henderson, J.L., Kormos, B.L., Hayward, M.M. et al. J Med Chem (2015) 58:419-432. DOI 10.1021/jm5014055 · PubMed
Other PDB entries of the same protein (UniProt Q9Y6E0 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4W8E directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.