The Fk1 domain of FKBP51 in complex with (1S,5S,6R)-10-[(3,5-dichlorophenyl)sulfonyl]-3-[2-(3,4-dimethoxyphenoxy)ethyl]-5-ethyl-3,10-diazabicyclo[4.3.1]decan-2-one. Determined by X-ray diffraction at 1.08 Å resolution. Released 3 Dec 2014.
Explore 4W9Q in 3D Show helices and sheets RCSB PDB PDBe
4W9Q contains 5 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 14-21 | 8 | |
| β-strand | 23-24 | 2 | 1 |
| β-strand | 33-39 | 7 | 1 |
| β-strand | 52-61 | 10 | 1 |
| β-strand | 66-69 | 4 | 1 |
| α-helix | 71-73 | 3 | |
| β-strand | 77-80 | 4 | 1 |
| α-helix | 88-95 | 8 | |
| α-helix | 97-98 | 2 | |
| β-strand | 102-107 | 6 | 1 |
| α-helix | 109-111 | 3 | |
| β-strand | 118 | 1 | 2 |
| β-strand | 122 | 1 | 2 |
| β-strand | 128-138 | 11 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Peptidyl-prolyl cis-trans isomerase FKBP5 | A | protein | 128 | Homo sapiens | Q13451 (AlphaFold model) |
>4W9Q_1 Peptidyl-prolyl cis-trans isomerase FKBP5 (chains A) GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHD RNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEI ELLDFKGE
| ID | Name | Formula | Copies |
|---|---|---|---|
| 3JP | (1S,5S,6R)-10-[(3,5-dichlorophenyl)sulfonyl]-3-[2-(3,4-dimethoxyphenoxy)ethyl]-… | C26 H32 Cl2 N2 O6 S | 1 |
Rational Design and Asymmetric Synthesis of Potent and Neurotrophic Ligands for FK506-Binding Proteins (FKBPs). Pomplun, S., Wang, Y., Kirschner, A. et al. Angew Chem Int Ed Engl (2015) 54:345-348. DOI 10.1002/anie.201408776 · PubMed
Other PDB entries of the same protein (UniProt Q13451 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4W9Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.