4WBP: Caprin-1

Crystal structure of the HR-1 domain of human caprin-1 in the P3121 space group. Determined by X-ray diffraction at 2.5 Å resolution. Released 21 Oct 2015.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,031
Mol. weight: 28.68 kDa
Released: 21 Oct 2015

Explore 4WBP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4WBP contains 16 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	134-158	25
α-helix	162-169	8
α-helix	180-193	14
α-helix	195-197	3
α-helix	203-206	4
α-helix	208-219	12
β-strand	224-225	2	1
β-strand	228-229	2	1
α-helix	230-243	14
α-helix	245-247	3

Chain B: 8 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	134-158	25
α-helix	162-169	8
α-helix	180-193	14
α-helix	195-198	4
α-helix	203-206	4
α-helix	208-219	12
β-strand	224-225	2	2
β-strand	228-229	2	2
α-helix	230-242	13
α-helix	245-247	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Caprin-1	A, B	protein	120	Homo sapiens	Q14444 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4WBP_1 Caprin-1 (chains A, B)
RREQLMREEAEQKRLKTVLELQYVLDKLGDDEVRTDLKQGLNGVPILSEEELSLLDEFYK
LVDPERDMSLRLNEQYEHASIHLWDLLEGKEKPVCGTTYKVLKEIVERVFQSNYFDSTHN

Primary citation

Crystal structure of the HR-1 domain of human caprin-1 in the P3121 space group. Wu, Y., Zhu, J., Huang, X. et al. To be published.

Other PDB entries of the same protein (UniProt Q14444 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9HFU 1.7 Å, Caprin1 peptide bound to SPOP MATH domain
6TA7 1.93 Å, Crystal structure of human G3BP1-NTF2 in complex with human CAPRIN1-derived solomon motif
4WBE 2.05 Å, Crystal structure of the HR-1 domain of human caprin-1 in the C121 space group
7XHG 2.46 Å, Crystal structure of the NTF2L domain of human G3BP1 in complex with the Caprin-1…
8TH7 2.88 Å, Crystal Structure of the G3BP1 NTF2-like domain bound to the Caprin1 peptide

Browse structure collections

About this viewer

MolViewer shows 4WBP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.