4WEE: Synaptotagmin 1 C2A

High-resolution structure of Synaptotagmin 1 C2A. Determined by X-ray diffraction at 0.89 Å resolution. Released 1 Oct 2014.

Method: X-ray diffraction
Resolution: 0.89 Å
Organism: Rattus norvegicus
Chains: 1
Atoms: 1,544
Mol. weight: 16.45 kDa
Released: 1 Oct 2014

Explore 4WEE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4WEE contains 9 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	132-137	6
α-helix	139-140	2
β-strand	144-152	9	1
β-strand	157-166	10	1
α-helix	168-170	3
α-helix	172-174	3
β-strand	179-186	8	2
α-helix	191-192	2
β-strand	193-194	2	2
α-helix	195-197	3
β-strand	205-212	8	1
α-helix	216-219	4
β-strand	223-230	8	2
α-helix	236-237	2
β-strand	238-246	9	2
α-helix	247-249	3
β-strand	256-261	6	1
β-strand	263	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Synaptotagmin-1	A	protein	144	Rattus norvegicus	P21707 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4WEE_1 Synaptotagmin-1 (chains A)
GSPGISGGGGGILDSMVEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVK
VFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGE
FKVPMNTVDFGHVTEEWRDLQSAE

Primary citation

The AD3 locus of synaptotagmin-1 C2 domains modulates domain stability. Dominguez, M.J., Bui, A.A., Villarreal, J. et al. Biophys J (2024). DOI 10.1016/j.bpj.2024.11.009 · PubMed

Other PDB entries of the same protein (UniProt P21707 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1TJX 1.04 Å, Crystallographic Identification of Ca2+ Coordination Sites in Synaptotagmin I C2B Domain
1UOW 1.04 Å, Calcium binding domain C2B
1TJM 1.18 Å, Crystallographic Identification of Sr2+ Coordination Site in Synaptotagmin I C2B Domain
2YOA 1.5 Å, Synaptotagmin-1 C2B domain with phosphoserine
1UOV 1.65 Å, Calcium binding domain C2B
5CCJ 1.65 Å, Crystal structure of the quintuple mutant of the synaptotagmin-1 C2B domain
8C5H 1.68 Å, NbSyt1 anti-(rat Synaptotagmin-1) nanobody bound to target cytosolic domain of…
6CXW 1.83 Å, Synaptotagmin 1 C2A beta4 chimera with enhanced PIP2 binding function
5W5C 1.85 Å, Crystal structure of the primed SNARE-Complexin-Synaptotagmin-1 C2AB complex
1RSY 1.9 Å, Structure of the first C2-domain of synaptotagmin I: a novel CA2+(SLASH)PHOSPHOLIPID…
5W5D 2.5 Å, Crystal structure of the primed SNARE-Complexin-Synaptotagmin-1 C2B complex
5CCG 3.5 Å, Structure of the Ca2+-bound synaptotagmin-1 SNARE complex (long unit cell form)

Browse structure collections

About this viewer

MolViewer shows 4WEE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.