4WFZ: RNA-directed RNA polymerase

Coxsackievirus B3 3Dpol RNA Dependent RNA Polymerase - NaCl Crystal Form. Determined by X-ray diffraction at 1.8 Å resolution. Released 22 Oct 2014.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Coxsackievirus B3
Chains: 1
Atoms: 4,188
Mol. weight: 52.5 kDa
Released: 22 Oct 2014

Explore 4WFZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4WFZ contains 29 α-helices and 21 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 29 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	2-8	7	1
α-helix	9-12	4
α-helix	14-17	4
β-strand	26-27	2	2
β-strand	39-40	2	3
α-helix	41-42	2
α-helix	54-59	6
α-helix	72-86	15
α-helix	94-96	3
α-helix	97-102	6
β-strand	104	1	4
β-strand	107	1	4
α-helix	108-111	4
α-helix	120-122	3
α-helix	127-130	4
α-helix	139-148	10
α-helix	152-153	2
β-strand	154-158	5	1
β-strand	162-163	2	3
α-helix	165-169	5
β-strand	175-178	4	1
α-helix	179-180	2
α-helix	181-200	20
β-strand	203	1	5
β-strand	208	1	5
α-helix	214-224	11
β-strand	228-230	3	5
β-strand	232-234	3	6
α-helix	237-240	4
α-helix	243-255	13
α-helix	264-270	7
β-strand	271-276	6	1
β-strand	279-284	6	1
α-helix	294-313	20
α-helix	319-321	3
β-strand	323-327	5	5
β-strand	330-335	6	5
α-helix	341-350	10
β-strand	355-357	3	6
β-strand	373-374	2	7
β-strand	377-381	5	7
β-strand	389-392	4	7
α-helix	395-402	8
β-strand	404-405	2	2
α-helix	408-410	3
α-helix	411-422	12
α-helix	423-425	3
α-helix	427-437	11
α-helix	441-445	5
α-helix	451-461	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RNA-directed RNA polymerase	A	protein	462	Coxsackievirus B3	P03313

Sequence of entity 1 (A), FASTA

>4WFZ_1 RNA-directed RNA polymerase (chains A)
GEIEFIESSKDAGFPVINTPSKTKLEPSVFHQVFEGNKEPAVLRSGDPRLKANFEEAIFS
KYIGNVNTHVDEYMLEAVDHYAGQLATLDISTEPMKLEDAVYGTEGLEALDLTTSAGYPY
VALGIKKRDILSKKTKDLTKLKECMDKYGLNLPMVTYVKDELRSIEKVAKGKSRLIEASS
LNDSVAMRQTFGNLYKTFHLNPGVVTGSAVGCDPDLFWSKIPVMLDGHLIAFDYSGYDAS
LSPVWFACLKMILEKLGYTHKETNYIDYLCNSHHLYRDKHYFVRGGMPSGCSGTSIFNSM
INNIIIRTLMLKVYKGIDLDQFRMIAYGDDVIASYPWPIDASLLAEAGKGYGLIMTPADK
GECFNEVTWTNVTFLKRYFRADEQYPFLVHPVMPMKDIHESIRWTKDPKNTQDHVRSLCL
LAWHNGEHEYEEFIRKIRSVPVGRCLTLPAFSTLRRKWLDSF

Primary citation

Structure-Function Relationships Underlying the Replication Fidelity of Viral RNA-Dependent RNA Polymerases. Campagnola, G., McDonald, S., Beaucourt, S. et al. J Virol (2015) 89:275-286. DOI 10.1128/JVI.01574-14 · PubMed

Other PDB entries of the same protein (UniProt P03313), best resolution first:

7W0Q 1.1 Å, TRIM7 in complex with C-terminal peptide of 2C
2ZU1 1.38 Å, crystal structure of CVB3 3C protease mutant C147A
7W0S 1.4 Å, TRIM7 in complex with C-terminal peptide of 2C
6S3A 1.52 Å, Coxsackie B3 2C protein in complex with S-Fluoxetine
7W0T 1.57 Å, TRIM7 in complex with C-terminal peptide of 2C
7QUW 1.65 Å, CVB3-3Cpro in complex with inhibitor MG-78
2ZTX 1.72 Å, Complex structure of CVB3 3C protease with EPDTC
2ZTY 1.72 Å, crystal structure of 3C protease from CVB3 in space group C2
2ZU3 1.75 Å, Complex structure of CVB3 3C protease with TG-0204998
4WFX 1.81 Å, Coxsackievirus B3 Polymerase - F232L Mutant - NaCl Crystal Form
6T3W 1.82 Å, Coxsackie B3 2C protein in complex with S-Fluoxetine
8S6F 1.93 Å, A Structural Investigation of the Interaction between a GC-376-Based Peptidomimetic…

Browse structure collections

About this viewer

MolViewer shows 4WFZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.