4WQO: VHL-EloB-EloC-Cul2

Structure of VHL-EloB-EloC-Cul2. Determined by X-ray diffraction at 3.2 Å resolution. Released 4 Mar 2015.

Method: X-ray diffraction
Resolution: 3.2 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,902
Mol. weight: 72.47 kDa
Released: 4 Mar 2015

Explore 4WQO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4WQO contains 28 α-helices and 29 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	71-79	9	1
α-helix	83	1
β-strand	84-89	6	2
β-strand	95-97	3	2
β-strand	101	1	2
β-strand	106-112	7	1
β-strand	116-121	6	2
β-strand	127	1	2
β-strand	129-130	2	1
β-strand	133	1	1
β-strand	136	1	2
α-helix	140-141	2
β-strand	142	1	3
β-strand	145	1	3
α-helix	146	1
β-strand	147-152	6	1
α-helix	158-169	12
α-helix	172-177	6
α-helix	183-189	7
α-helix	194-206	13

Chain B: 8 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	2-8	7	4
β-strand	12-19	8	4
β-strand	23	1	5
α-helix	24-35	12
α-helix	39-41	3
β-strand	42-45	4	4
α-helix	49	1
β-strand	50	1	4
α-helix	51-52	2
β-strand	56	1	5
β-strand	68	1	6
β-strand	71	1	6
α-helix	72	1
β-strand	73-79	7	4
β-strand	80	1	7
β-strand	85	1	7
α-helix	86-88	3
α-helix	98-100	3
α-helix	101-103	3

Chain C: 6 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	18-22	5	4
β-strand	28-32	5	4
α-helix	33-36	4
α-helix	40-45	6
β-strand	59-61	3	4
α-helix	67-83	17
α-helix	89-92	4
α-helix	97-99	3
α-helix	100-110	11

Chain D: 7 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	7	1	8
α-helix	10-25	16
α-helix	32-47	16
β-strand	49	1	8
α-helix	54-77	24
α-helix	85-104	20
α-helix	106-107	2
α-helix	108-112	5
α-helix	139-156	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Von Hippel-Lindau disease tumor suppressor	A	protein	233	Homo sapiens	P40337 (AlphaFold model)
Transcription elongation factor B polypeptide 2	B	protein	118	Homo sapiens	Q15370 (AlphaFold model)
Transcription elongation factor B polypeptide 1	C	protein	96	Homo sapiens	Q15369 (AlphaFold model)
Cullin-2	D	protein	186	Homo sapiens	Q13617 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4WQO_1 Von Hippel-Lindau disease tumor suppressor (chains A)
MGSSHHHHHHSSGLVPRGSHMPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGP
EESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPT
LPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKE
RCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD

Sequence of entity 2 (B), FASTA

>4WQO_2 Transcription elongation factor B polypeptide 2 (chains B)
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEC
GFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ

Sequence of entity 3 (C), FASTA

>4WQO_3 Transcription elongation factor B polypeptide 1 (chains C)
MYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMY
FTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC

Sequence of entity 4 (D), FASTA

>4WQO_4 Cullin-2 (chains D)
MGSSHHHHHHSQDPTTVKLQAGFMSLKPRVVDFDETWNKLLTTIKAVVMLEYVERATWND
RFSDIYALCVAYPEPLGERLYTETKIFLENHVRHLHKRVLESEEQVLVMYHRYWEEYSKG
ADYMDCLYRYLNTQFIKKNKLTEADLQYGYGGVDMNEPLMEIGELALDMWRKLMVEPLQA
ILIRML

Primary citation

Insights into Cullin-RING E3 Ubiquitin Ligase Recruitment: Structure of the VHL-EloBC-Cul2 Complex. Nguyen, H.C., Yang, H., Fribourgh, J.L. et al. Structure (2015) 23:441-449. DOI 10.1016/j.str.2014.12.014 · PubMed

Other PDB entries of the same protein (UniProt P40337 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7Z76 1.32 Å, Crystal structure of compound 10 in complex with the bromodomain of human SMARCA2 and…
9GIO 1.49 Å, Crystal structure of the VHL-EloC-EloB complex with a covalent compound bound to C77 of…
7JTO 1.7 Å, Crystal structure of Protac MS33 in complex with the WD repeat-containing protein 5 and…
8BDS 1.72 Å, Ternary complex between VCB, BRD4-BD1 and PROTAC 48
4AJY 1.73 Å, von Hippel-Lindau protein-ElonginB-ElonginC complex, bound to Hif1- alpha peptide
6GMR 1.75 Å, pVHL:EloB:EloC in complex with (4-(1H-pyrrol-1-yl)phenyl)methanol
6HR2 1.76 Å, Crystal structure of PROTAC 2 in complex with the bromodomain of human SMARCA4 and…
6I7Q 1.8 Å, Structure of pVHL-elongin B-elongin C (VCB) in complex with hydroxylated-HIF-2alpha…
8BB3 1.8 Å, Structure of human WDR5 and pVHL:ElonginC:ElonginB bound to PROTAC with PEG linker…
6GFX 1.83 Å, pVHL:EloB:EloC in complex with modified HIF-1a CODD peptide containing…
1LM8 1.85 Å, Structure of a HIF-1a-pVHL-ElonginB-ElonginC Complex
6ZHC 1.92 Å, PROTAC6 mediated complex of VHL:EloB:EloC and Bcl-xL

Browse structure collections

About this viewer

MolViewer shows 4WQO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.