4WW4: RuvB-like 1

Double-heterohexameric rings of full-length Rvb1(ADP)/Rvb2(ADP). Determined by X-ray diffraction at 2.94 Å resolution. Released 18 Feb 2015.

Method: X-ray diffraction
Resolution: 2.94 Å
Organism: Chaetomium thermophilum
Chains: 2
Atoms: 6,603
Mol. weight: 107.25 kDa
Ligands: ADP
Released: 18 Feb 2015

Explore 4WW4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4WW4 contains 43 α-helices and 46 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	27	1	1
β-strand	33	1	1
β-strand	36-37	2	2
β-strand	40-41	2	2
α-helix	44-59	16
β-strand	66-71	6	3
α-helix	77-88	12
β-strand	94-98	5	3
α-helix	99-102	4
α-helix	109-118	10
β-strand	121-135	15	4
β-strand	163-164	2	4
β-strand	167-168	2	4
β-strand	191-195	5	4
β-strand	207	1	5
α-helix	208-210	3
β-strand	222	1	5
α-helix	223-225	3
β-strand	230-240	11	4
α-helix	241-248	8
α-helix	258-261	4
α-helix	274-289	16
β-strand	293-297	5	4
β-strand	299-303	5	3
α-helix	305-307	3
β-strand	309	1	6
α-helix	310-321	12
α-helix	326	1
β-strand	327-332	6	3
β-strand	336-338	3	7
β-strand	340	1	6
β-strand	346-348	3	7
α-helix	353-358	6
β-strand	359-364	6	3
α-helix	365-368	4
α-helix	369-383	15
β-strand	387	1	8
α-helix	389-401	13
α-helix	404-408	5
α-helix	411-421	11
β-strand	426	1	8
α-helix	428-437	10
β-strand	439	1	9
α-helix	441-450	10

Chain B: 23 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	12-15	4
α-helix	22-24	3
β-strand	32	1	10
α-helix	38	1
β-strand	39	1	10
α-helix	40	1
β-strand	42-43	2	11
β-strand	46-47	2	11
α-helix	50-65	16
β-strand	73-76	4	9
α-helix	83-92	10
β-strand	100-104	5	9
α-helix	105-108	4
α-helix	115-124	10
β-strand	127-148	22	12
β-strand	157-163	7	12
β-strand	168-173	6	12
α-helix	175-183	9
β-strand	190-195	6	12
β-strand	201-206	6	12
α-helix	224-228	5
β-strand	233-242	10	12
α-helix	243-250	8
α-helix	252-253	2
α-helix	258-260	3
α-helix	266-268	3
α-helix	269-285	17
β-strand	288-292	5	12
β-strand	294-298	5	9
α-helix	300-302	3
β-strand	304	1	13
α-helix	305-315	11
β-strand	322-327	6	9
β-strand	331-333	3	14
β-strand	335	1	13
β-strand	340-342	3	14
α-helix	347-352	6
β-strand	354-357	4	9
α-helix	360-362	3
α-helix	363-376	14
β-strand	381	1	15
α-helix	383-414	32
β-strand	420	1	15
α-helix	422-431	10
α-helix	435-446	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RuvB-like 1	A	protein	462	Chaetomium thermophilum	G0RYI5 (AlphaFold model)
RuvB-like 2	B	protein	513	Chaetomium thermophilum	G0RYC2 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4WW4_1 RuvB-like 1 (chains A)
MVQISEVRGNTRDHRTAAHTHIKGLGLNSSGIAEKQAAGFVGQCAAREACGVVVDLIKAH
KMAGRGVLLAGGPGTGKTALALAISQELGTKIPFCPITGSEIYSTEVKKTEVLMENFRRA
IGLRVRETKDVYEGEVTEMTPEEAENPLGGYGKTISTLLIGLKSARGQKKLRLDPSIYEA
IQKERVQVGDVIYIETNTGACKRVGRSDAYATEFDLEAEEYVPIPKGEVHKKKEIVQDVT
LHDLDVANARPQGGQDIISMMGQLMKPKMTEITDKLRMEINKVVQKYINQGVAELIPGVL
FIDEAHMLDIECFTYLNKALESPIAPIVVLASNRGIATIRGADDLKAAHGIPPDFLQRLL
IIPTHPYEPDEIRRIVRIRAQTEGVQLTDAAVDRVAEHGVRISLRYCLQLLAPASILARV
NGRTQVDVQDIAEAEELFLDARRSANILTSTGESGGLHGFIS

Sequence of entity 2 (B), FASTA

>4WW4_2 RuvB-like 2 (chains B)
MGSSHHHHHHHHSSGLEVLFQGPGSMAAPLVTSVTETKELRGLNLIAAHSHIRGLGVDAD
TLEPRPSSQGLVGQEKARKAAAVVLEMIKQGKIAGRAVLIAGPPSTGKTAIAMGMAQSLG
QDVPFTTLAASEIFSLEMSKTEALTQAFRKSIGVRIKEESEIMEGEVVEIQIDRSVTGGA
KQGKLTIKTTDMEAIYDMGSKMIDAMTKERVMAGDIISIDKSSGKITKLGRSYARSRDYD
AMGVDTKFLQCPEGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIRSEIRDQI
NTKVAEWKEEGKAEIVPGVLFIDEVHMLDIECFSYINRALESDLAPIVIMASNRGVSRIR
GTDYKSPHGLPLDFLDRVVIINTHPYTPDELRQILSIRAQEEEVDLTPDALALLTKIGQE
AGLRYASNLITTSQLIAAKRRAKQVGVEDVQRSFKLFYDPARSVRFVQESEKRLIGNDGV
VDFSYQGAAEAAAPTLPAAAPVDPVGGEKMDMS

Ligands and cofactors

ID	Name	Formula	Copies
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	2

Primary citation

Structural Basis for Dodecameric Assembly States and Conformational Plasticity of the Full-Length AAA+ ATPases Rvb1Rvb2. Lakomek, K., Stoehr, G., Tosi, A. et al. Structure (2015) 23:483-495. DOI 10.1016/j.str.2014.12.015 · PubMed

Other PDB entries of the same protein (UniProt G0RYI5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8OOP 2.7 Å, CryoEM Structure INO80core Hexasome complex composite model state2
8OO7 2.8 Å, CryoEM Structure INO80core Hexasome complex composite model state1
8OOR 2.87 Å, CryoEM Structure INO80core Hexasome complex Rvb core refinement state2
5FM7 2.9 Å, Double-heterohexameric rings of full-length Rvb1(ADP)Rvb2(ADP)
8OOC 2.93 Å, CryoEM Structure INO80core Hexasome complex Rvb core refinement state1
5FM6 3.0 Å, Double-heterohexameric rings of full-length Rvb1(ADP)Rvb2(apo)
4WVY 3.64 Å, Double-heterohexameric rings of full-length Rvb1(ATP)/Rvb2(apo)
6FHS 3.75 Å, CryoEM Structure of INO80core
6FML 4.34 Å, CryoEM Structure INO80core Nucleosome complex
8AV6 4.68 Å, CryoEM structure of INO80 core nucleosome complex in closed grappler conformation

Browse structure collections

About this viewer

MolViewer shows 4WW4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.