4WZG: Human ATG101

Structure of human ATG101. Determined by X-ray diffraction at 1.9 Å resolution. Released 17 Jun 2015.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,632
Mol. weight: 25.11 kDa
Released: 17 Jun 2015

Explore 4WZG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4WZG contains 9 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	4-13	10	1
α-helix	14-16	3
α-helix	17-30	14
β-strand	33-34	2	2
α-helix	35-36	2
β-strand	37-39	3	3
α-helix	41-43	3
β-strand	45-47	3	3
β-strand	52-56	5	4
β-strand	63-67	5	4
α-helix	70-88	19
β-strand	95-106	12	1
β-strand	115-129	15	1
α-helix	134-161	28
α-helix	166-169	4
α-helix	171-176	6
β-strand	178	1	5
β-strand	186-187	2	2
β-strand	188	1	5
α-helix	189	1
β-strand	190-197	8	1
β-strand	202-207	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Autophagy-related protein 101	A	protein	218	Homo sapiens	Q9BSB4 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4WZG_1 Autophagy-related protein 101 (chains A)
MNCRSEVLEVSVEGRQVEEAMLAVLHTVLLHRSTGKFHYKKEGTYSIGTVGTQDVDCDFI
DFTYVRVSSEELDRALRKVVGEFKDALRNSGGDGLGQMSLEFYQKKKSRWPFSDECIPWE
VWTVKVHVVALATEQERQICREKVGEKLCEKIINIVEVMNRHEYLPKMPTQSEVDNVFDT
GLRDVQPYLYKISFQITDALGTSVTTTMRRLIKDTLAL

Primary citation

The mammalian autophagy initiator complex contains 2 HORMA domain proteins. Michel, M., Schwarten, M., Decker, C. et al. Autophagy (2015) 11:2300-2308. DOI 10.1080/15548627.2015.1076605 · PubMed

Other PDB entries of the same protein (UniProt Q9BSB4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5C50 1.63 Å, Crystal structure of the complex of human Atg101-Atg13 HORMA domain
5XUY 2.2 Å, Crystal structure of ATG101-ATG13HORMA
8DO8 2.41 Å, Crystal structure ATG9 HDIR in complex with the ATG13:ATG101 HORMA dimer
5XV6 2.46 Å, Crystal structure of ATG101-ATG13HORMA
5XV1 2.51 Å, Crystal structure of ATG101-ATG13HORMA
5XV3 2.57 Å, Crystal structure of ATG101-ATG13HORMA
5XV4 2.95 Å, Crystal structure of ATG101-ATG13HORMA

Browse structure collections

About this viewer

MolViewer shows 4WZG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.