4X25: Profilin-1

Structural basis for mutation-induced destabilization of Profilin 1 in ALS. Determined by X-ray diffraction at 2.23 Å resolution. Released 10 Jun 2015.

Method: X-ray diffraction
Resolution: 2.23 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,072
Mol. weight: 30.08 kDa
Released: 10 Jun 2015

Explore 4X25 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4X25 contains 10 α-helices and 17 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	5-11	7
β-strand	17-24	8	1
β-strand	30-34	5	1
α-helix	40-42	3
α-helix	45-51	7
β-strand	55	1	2
α-helix	58-61	4
β-strand	64-66	3	1
β-strand	69-77	9	1
β-strand	85-90	6	1
β-strand	100-105	6	1
β-strand	109-115	7	1
α-helix	121-137	17

Chain B: 5 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	5-11	7
β-strand	17-24	8	3
β-strand	30-34	5	3
α-helix	40-42	3
α-helix	45-51	7
β-strand	55	1	2
α-helix	58-62	5
β-strand	64-66	3	4
β-strand	69-71	3	4
β-strand	72-76	5	3
β-strand	85-89	5	3
β-strand	100-105	6	3
β-strand	109-115	7	3
α-helix	121-137	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Profilin-1	A, B	protein	140	Homo sapiens	P07737 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4X25_1 Profilin-1 (chains A, B)
MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFY
VNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLTGKEGVH
GGLINKKCYEMASHLRRSQY

Primary citation

Structural basis for mutation-induced destabilization of profilin 1 in ALS. Boopathy, S., Silvas, T.V., Tischbein, M. et al. Proc Natl Acad Sci U S A (2015) 112:7984-7989. DOI 10.1073/pnas.1424108112 · PubMed

Other PDB entries of the same protein (UniProt P07737 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2PBD 1.5 Å, Ternary complex of profilin-actin with the poly-PRO-GAB domain of VASP*
8BJH 1.69 Å, chimera of the inactive ExoY Nucleotidyl Cyclase domain from Vibrio nigripulchritudo…
8BJJ 1.7 Å, ExoY Nucleotidyl Cyclase domain from Vibrio nigripulchritudo MARTX toxin, bound to…
8BJI 1.75 Å, chimera of ExoY Nucleotidyl Cyclase domain from Vibrio nigripulchritudo fused to a…
2PAV 1.8 Å, Ternary complex of Profilin-Actin with the Last Poly-Pro of Human VASP
1FIL 2.0 Å, Human platelet profilin I crystallized in high salt actin-binding protein
6NBE 2.0 Å, Ternary Complex of Ac-Alpha-Actin with Profilin and CoA-NAA80
4X1L 2.16 Å, Structural basis for mutation-induced destabilization of Profilin 1 in ALS
4X1M 2.17 Å, Structural basis for mutation-induced destabilization of Profilin 1 in ALS
1AWI 2.2 Å, Human platelet profilin complexed with the L-PRO10 peptide
1CF0 2.2 Å, Human platelet profilin complexed with an L-PRO10-iodotyrosine peptide
8BR0 2.22 Å, ExoY Nucleotidyl Cyclase domain from Vibrio nigripulchritudo MARTX toxin (residue Q3455…

Browse structure collections

About this viewer

MolViewer shows 4X25 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.