4X3G: SIAH1 SINA domain

Crystal structure of SIAH1 SINA domain in complex with a USP19 peptide. Determined by X-ray diffraction at 2.34 Å resolution. Released 31 Dec 2014.

Method: X-ray diffraction
Resolution: 2.34 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,173
Mol. weight: 46.59 kDa
Ligands: ZN
Released: 31 Dec 2014

Explore 4X3G in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4X3G contains 21 α-helices and 34 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	94	1
β-strand	95-97	3	1
β-strand	108-110	3	1
α-helix	111-120	10
α-helix	125	1
β-strand	126-127	2	2
α-helix	128	1
β-strand	138-139	2	2
α-helix	141-143	3
α-helix	144-151	8
β-strand	157-159	3	3
β-strand	162-168	7	4
β-strand	177-184	8	3
β-strand	187-196	10	3
β-strand	204-211	8	3
α-helix	215-218	4
β-strand	221-229	9	4
β-strand	232-238	7	4
α-helix	239-240	2
β-strand	241-242	2	3
α-helix	248-252	5
β-strand	257-260	4	3
α-helix	261-267	7
β-strand	268-269	2	4
β-strand	272-281	10	4

Chain B: 9 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	96-97	2	5
β-strand	108-109	2	5
α-helix	111-118	8
α-helix	125	1
β-strand	126-127	2	6
α-helix	128	1
β-strand	138-139	2	6
α-helix	141-143	3
α-helix	144-150	7
β-strand	157-159	3	7
β-strand	162-167	6	4
β-strand	176-184	9	7
β-strand	187-199	13	7
β-strand	202-211	10	7
α-helix	215-218	4
β-strand	221-228	8	4
β-strand	232-238	7	4
α-helix	239-240	2
β-strand	241-242	2	7
α-helix	248-252	5
β-strand	257-260	4	7
α-helix	261-267	7
β-strand	269	1	8
β-strand	272	1	8
β-strand	273-281	9	4

Chain C: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	465-468	4	4
α-helix	469-471	3

Chain D: 1 helix, 2 β-strands

Element	Residues	Length	Sheet
β-strand	465-468	4	4
α-helix	469-470	2
β-strand	471	1	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin-protein ligase SIAH1	A, B	protein	193	Homo sapiens	Q8IUQ4 (AlphaFold model)
Ubiquitin carboxyl-terminal hydrolase 19	C, D	protein	14	Homo sapiens	O94966 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4X3G_1 E3 ubiquitin-protein ligase SIAH1 (chains A, B)
GANSVLFPCKYASSGCEITLPHTEKADHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLM
HQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEKYDGHQQFFAIV
QLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAE
NGNLGINVTISMC

Sequence of entity 2 (C, D), FASTA

>4X3G_2 Ubiquitin carboxyl-terminal hydrolase 19 (chains C, D)
SPKPTCMVPPMPHS

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	4

Primary citation

Crystal structure of SIAH1 SINA domain in complex with a USP19 peptide. Walker, J.R., Dong, A., Zhang, Q. et al. To be published.

Other PDB entries of the same protein (UniProt Q8IUQ4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4CA1 1.58 Å, Crystal structure of Siah1 at 1.58 A resolution.
9G0L 1.9 Å, Crystal structure of the RING-ZnF1 fragment of SIAH1
4C9Z 1.95 Å, Crystal structure of Siah1 at 1.95 A resolution
5WZZ 2.1 Å, The SIAH E3 ubiquitin ligases promote Wnt/ beta-catenin signaling through mediating…
2A25 2.2 Å, Crystal structure of Siah1 SBD bound to the peptide EKPAAVVAPITTG from SIP
4I7D 2.4 Å, Siah1 bound to synthetic peptide (ACE)KLRPVAMVRP(PRK)VR
8HEO 2.53 Å, Crystal structure of SIAH1 SBD bound to Axin2 peptide
4I7C 2.8 Å, Siah1 mutant bound to synthetic peptide (ACE)KLRPV(23P)MVRPWVR
4I7B 3.0 Å, Siah1 bound to synthetic peptide (ACE)KLRPV(ABA)MVRPTVR

Browse structure collections

About this viewer

MolViewer shows 4X3G directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.