4X6B: BK6 TCR apo structure

BK6 TCR apo structure. Determined by X-ray diffraction at 2.1 Å resolution. Released 28 Jan 2015.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 4
Atoms: 7,413
Mol. weight: 101.19 kDa
Released: 28 Jan 2015

Explore 4X6B in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4X6B contains 29 α-helices and 89 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	3-5	3	1
β-strand	10-13	4	2
β-strand	18-24	7	1
β-strand	29-37	9	2
β-strand	44-50	7	2
β-strand	53-57	5	1
β-strand	60-65	6	1
β-strand	70-75	6	1
α-helix	80-82	3
β-strand	84-92	9	2
α-helix	95	1
β-strand	101-102	2	2
α-helix	103	1
β-strand	106-111	6	2
α-helix	112-113	2
β-strand	120-123	4	3
α-helix	124	1
β-strand	125	1	4
β-strand	133-138	6	3
β-strand	145	1	5
α-helix	146-149	4
β-strand	155-164	10	3
α-helix	165-167	3
β-strand	169-178	10	3
α-helix	185-188	4
β-strand	193	1	5
β-strand	199	1	3

Chain B: 7 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	6
β-strand	10-14	5	7
β-strand	19-25	7	6
β-strand	31-37	7	7
β-strand	43-51	9	7
β-strand	54-57	4	7
β-strand	65-70	6	6
β-strand	73-78	6	6
α-helix	83-85	3
β-strand	87-94	8	7
β-strand	105-106	2	7
β-strand	110-115	6	7
α-helix	118-120	3
β-strand	122	1	8
α-helix	123-124	2
β-strand	125-129	5	9
β-strand	130	1	4
α-helix	131-132	2
α-helix	133-139	7
β-strand	141-151	11	9
β-strand	152	1	8
β-strand	156-162	7	10
β-strand	165-167	3	10
β-strand	171-173	3	9
β-strand	178-179	2	9
β-strand	189-198	10	9
α-helix	199-202	4
β-strand	208-215	8	10
β-strand	218	1	11
α-helix	229-230	2
β-strand	232	1	11
β-strand	234-241	8	10

Chain C: 7 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	3-5	3	12
β-strand	10-13	4	13
β-strand	18-24	7	12
β-strand	29-37	9	13
β-strand	44-50	7	13
β-strand	53-57	5	12
β-strand	60-65	6	12
β-strand	70-75	6	12
α-helix	80-82	3
β-strand	84-92	9	13
α-helix	95	1
β-strand	101-102	2	13
α-helix	103	1
β-strand	106-111	6	13
α-helix	112-113	2
β-strand	120-123	4	14
α-helix	124	1
β-strand	125	1	15
β-strand	134-138	5	14
β-strand	145	1	16
α-helix	146-149	4
β-strand	155-157	3	14
β-strand	161-162	2	17
β-strand	173-177	5	14
α-helix	185-188	4
β-strand	193	1	16
β-strand	199	1	14

Chain D: 7 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	18
β-strand	10-14	5	19
β-strand	19-25	7	18
β-strand	31-37	7	19
β-strand	43-51	9	19
β-strand	54-57	4	19
β-strand	65-70	6	18
β-strand	73-78	6	18
α-helix	83-85	3
β-strand	87-94	8	19
β-strand	105-106	2	19
β-strand	110-115	6	19
α-helix	118-120	3
β-strand	122	1	20
α-helix	123-124	2
β-strand	125-129	5	17
β-strand	130	1	15
α-helix	131-132	2
α-helix	133-139	7
β-strand	141-151	11	17
β-strand	152	1	20
β-strand	156-162	7	21
β-strand	165-167	3	21
β-strand	171-173	3	17
β-strand	178-179	2	17
β-strand	189-198	10	17
α-helix	199-203	5
β-strand	208-215	8	21
β-strand	218	1	22
α-helix	229-230	2
β-strand	232	1	22
β-strand	234-241	8	21

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
TCR alpha	A, C	protein	207	Homo sapiens	P01848 (AlphaFold model)
TCR beta	B, D	protein	245	Homo sapiens	P01850 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>4X6B_1 TCR alpha (chains A, C)
QKEVEQDPGPLSVPEGAIVSLNCTYSNSAFQYFMWYRQYSRKGPELLMYTYSSGNKEDGR
FTAQVDKSSKYISLFIRDSQPSDSATYLCAMSTSLPNAGKSTFGDGTTLTVKPNIQNPDP
AVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSN
KSDFACANAFNNSIIPEDTFFPSPESS

Sequence of entity 2 (B, D), FASTA

>4X6B_2 TCR beta (chains B, D)
NAGVTQTPKFRVLKTGQSMTLLCAQDMNHEYMYWYRQDPGMGLRLIHYSVGEGTTAKGEV
PDGYNVSRLKKQNFLLGLESAAPSQTSVYFCASRYFLPTQGMGAFFGQGTRLTVVEDLNK
VFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKE
QPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEA
WGRAD

Primary citation

alpha beta T cell antigen receptor recognition of CD1a presenting self lipid ligands. Birkinshaw, R.W., Pellicci, D.G., Cheng, T.Y. et al. Nat Immunol (2015) 16:258-266. DOI 10.1038/ni.3098 · PubMed

Other PDB entries of the same protein (UniProt P01848 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4UDT 1.35 Å, T cell receptor (TRAV22,TRBV7-9) structure
4WW1 1.38 Å, Crystal structure of human TCR Alpha Chain-TRAV21-TRAJ8 and Beta Chain-TRBV7-8
1OGA 1.4 Å, A structural basis for immunodominant human T-cell receptor recognition.
2BNU 1.4 Å, Structural and kinetic basis for heightened immunogenicity of T cell vaccines
1KGC 1.5 Å, Immune Receptor
2BNQ 1.7 Å, Structural and kinetic basis for heightened immunogenicity of T cell vaccines
2BNR 1.9 Å, Structural and kinetic basis for heightened immunogenicity of T cell vaccines
2IAL 1.92 Å, Structural basis for recognition of mutant self by a tumor-specific, MHC class…
5C0C 1.97 Å, 1E6 TCR in complex with HLA-A02 carrying RQFGPDWIVA
2VLM 1.98 Å, The Structural Dynamics and Energetics of an Immunodominant T-cell Receptor are…
5KSA 2.0 Å, Bel602-DQ8.5-glia-gamma1 complex
7RYL 2.0 Å, T cell receptor CO3

Browse structure collections

About this viewer

MolViewer shows 4X6B directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.