4XDX: Interleukin-8

The crystal structure of soluble human interleukin 8 expressed in Pichia pastoris. Determined by X-ray diffraction at 0.95 Å resolution. Released 23 Dec 2015.

Method: X-ray diffraction
Resolution: 0.95 Å
Organism: Homo sapiens
Chains: 1
Atoms: 818
Mol. weight: 8.24 kDa
Released: 23 Dec 2015

Explore 4XDX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4XDX contains 2 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	19-21	3
β-strand	22-28	7	1
β-strand	31	1	2
β-strand	34	1	2
β-strand	38-43	6	1
β-strand	48-51	4	1
α-helix	56-70	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin-8	A	protein	70	Homo sapiens	P10145 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4XDX_1 Interleukin-8 (chains A)
KELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVV
EKFLKRAENS

Primary citation

The crystal structure of soluble human interleukin 8 expressed in Pichia pastoris. Ostrov, D.A., Pompeu, Y.A., Jakoncic, J.J. To be published.

Other PDB entries of the same protein (UniProt P10145 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5D14 1.0 Å, The atomic resolution crystal structure of human IL-8
6N2U 1.25 Å, IL-8 Structure from Bacterial Expression Source
3IL8 2.0 Å, Crystal structure of interleukin 8: symbiosis of NMR and crystallography
1ICW 2.01 Å, Interleukin-8, mutant with glu 38 replaced by cys and cys 50 replaced by ala
9YIP 2.2 Å, Crystal structure of human IL-8 in a large unit cell
6WZM 2.28 Å, LY3041658 Fab bound to CXCL8
1QE6 2.35 Å, Interleukin-8 with an added disulfide between residues 5 and 33 (L5C/H33C)
8XX6 2.99 Å, Structure of CXCR2 bound to CXCL8 (CXCR2-CXCL8-Go Full map)
8XWN 3.29 Å, Structure of CXCR2 bound to CXCL8 (Ligand-receptor focused map)
6LFO 3.4 Å, Cryo-EM structure of a class A GPCR monomer
8IC0 3.41 Å, Cryo-EM structure of CXCL8 bound C-X-C chemokine receptor 1 in complex with Gi…
6LFM 3.5 Å, Cryo-EM structure of a class A GPCR

Browse structure collections

About this viewer

MolViewer shows 4XDX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.