4XFT: IL-18 SER Mutant III

Structure of IL-18 SER Mutant III. Determined by X-ray diffraction at 2.0 Å resolution. Released 10 Jun 2015.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,659
Mol. weight: 36.2 kDa
Released: 10 Jun 2015

Explore 4XFT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4XFT contains 14 α-helices and 26 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	2-14	13	1
α-helix	18	1
β-strand	19-22	4	1
β-strand	28-31	4	1
α-helix	35-40	6
α-helix	42-45	4
β-strand	47-54	8	1
β-strand	60-66	7	1
β-strand	73-75	3	1
α-helix	77-79	3
β-strand	82-84	3	1
α-helix	87-89	3
β-strand	91-92	2	1
β-strand	101-105	5	1
α-helix	106	1
β-strand	113-117	5	1
β-strand	123-130	8	1
β-strand	133-140	8	1
α-helix	147-149	3
β-strand	151-154	4	1

Chain B: 7 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	2-13	12	2
α-helix	18	1
β-strand	19-22	4	2
β-strand	28-31	4	2
α-helix	35-40	6
α-helix	42-45	4
β-strand	47-54	8	2
β-strand	60-66	7	2
β-strand	73-75	3	2
α-helix	77-79	3
β-strand	82-84	3	2
α-helix	87-89	3
β-strand	91-92	2	2
β-strand	101-105	5	2
α-helix	106-107	2
β-strand	113-117	5	2
β-strand	123-130	8	2
β-strand	133-140	8	2
α-helix	147-149	3
β-strand	151-155	5	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin-18	A, B	protein	157	Homo sapiens	Q14116 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4XFT_1 Interleukin-18 (chains A, B)
YFGKLESKLSVIRNLNDQVLFIDQGNRPLFEDMTDSDCRDNAPRTIFIISMYKDSQPRGM
AVTISVACAAASTLSCENKIISFKEMNPPDNIKDTKSDIIFFQRSVPGHDNKMQFESSSY
EGYFLACEKERDLFKLILKKEDELGDRSIMFTVQNED

Primary citation

Crystallization of interleukin-18 for structure-based inhibitor design. Krumm, B., Meng, X., Xiang, Y. et al. Acta Crystallogr F Struct Biol Commun (2015) 71:710-717. DOI 10.1107/S2053230X15006871 · PubMed

Other PDB entries of the same protein (UniProt Q14116 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2VXT 1.49 Å, Crystal structure of human IL-18 complexed to murine reference antibody 125-2H Fab
9OD9 1.6 Å, Structure of disulfide-stabilized IL-18 variant
4EKX 1.75 Å, Crystal Structure of YLDV 14L IL-18 Binding Protein in Complex with Human IL-18
7AL7 1.8 Å, The Crystal Structure of Human IL-18 in Complex With Human IL-18 Binding Protein
9OD7 1.9 Å, Structure of disulfide-stabilized IL-18 variant
4XFS 1.91 Å, Structure of IL-18 SER Mutant I
3F62 2.0 Å, Crystal Structure of Human IL-18 in complex with Ectromelia virus IL-18 Binding Protein
4HJJ 2.1 Å, Structure Reveals Function of the Dual Variable Domain Immunoglobulin (DVD-Ig) Molecule
3WO2 2.33 Å, Crystal structure of human interleukin-18
4EEE 2.71 Å, Crystal Structure of YLDV 14L IL-18 Binding Protein in Complex with Human IL-18
4R6U 2.8 Å, IL-18 receptor complex
4XFU 2.85 Å, Structure of IL-18 SER Mutant V

Browse structure collections

About this viewer

MolViewer shows 4XFT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.