Structure of disulfide-stabilized IL-18 variant. Determined by X-ray diffraction at 1.9 Å resolution. Released 30 Jul 2025.
Explore 9OD7 in 3D Show helices and sheets RCSB PDB PDBe
9OD7 contains 6 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 38-49 | 12 | 1 |
| α-helix | 54 | 1 | |
| β-strand | 55-58 | 4 | 1 |
| β-strand | 64-67 | 4 | 1 |
| α-helix | 74-77 | 4 | |
| α-helix | 78-81 | 4 | |
| β-strand | 83-90 | 8 | 1 |
| β-strand | 96-103 | 8 | 1 |
| β-strand | 107-111 | 5 | 1 |
| α-helix | 113-115 | 3 | |
| β-strand | 118-120 | 3 | 1 |
| α-helix | 123-125 | 3 | |
| β-strand | 127-128 | 2 | 1 |
| β-strand | 137-142 | 6 | 1 |
| β-strand | 145-153 | 9 | 1 |
| β-strand | 159-166 | 8 | 1 |
| β-strand | 169-176 | 8 | 1 |
| α-helix | 183-185 | 3 | |
| β-strand | 187-191 | 5 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Interleukin-18 | A | protein | 166 | Homo sapiens | Q14116 (AlphaFold model) |
>9OD7_1 Interleukin-18 (chains A) YFGKLESKCSVIRNLNDQVLFIDQGNRPLFEDMTDSDSRDNAPRTIFIISMYKDSQPRGM AVTISVKSEKISTLSSENKIISFKEMNPPDNIKDTKSDIIFFQRSVPGHDNKMQFESSSY EGYFLASEKERDLFKLILKKEDELGDRSIMFTVQNCDGGGENLYFQ
Engineered IL-18 variants with half-life extension and improved stability for cancer immunotherapy. Bainbridge, T.W., Wang, L., Moskalenko, M. et al. J Immunother Cancer (2025) 13. DOI 10.1136/jitc-2025-011789 · PubMed
Other PDB entries of the same protein (UniProt Q14116 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9OD7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.