4XPM: EGO-TC

Crystal structure of EGO-TC. Determined by X-ray diffraction at 2.4 Å resolution. Released 5 Aug 2015.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Chains: 3
Atoms: 1,997
Mol. weight: 30.89 kDa
Released: 5 Aug 2015

Explore 4XPM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4XPM contains 11 α-helices and 15 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
α-helix	154-171	18
β-strand	181-182	2	1

Chain B: 4 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	11-16	6	2
β-strand	21-26	6	2
α-helix	27-30	4
α-helix	32-34	3
α-helix	35-38	4
α-helix	41-43	3
β-strand	48-52	5	2
β-strand	56-63	8	2
β-strand	66-73	8	2

Chain C: 6 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	3-4	2	1
α-helix	6-16	11
α-helix	18-20	3
β-strand	21	1	3
β-strand	28	1	3
α-helix	29-32	4
β-strand	34-39	6	4
β-strand	45-50	6	4
α-helix	66-83	18
β-strand	94-100	7	4
β-strand	103-112	10	4
β-strand	115-121	7	4
β-strand	127-134	8	4
α-helix	139-151	13
α-helix	154-156	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein MEH1	A	protein	39	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	Q02205 (AlphaFold model)
Uncharacterized protein YCR075W-A	B	protein	76	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	Q3E830 (AlphaFold model)
Protein SLM4	C	protein	162	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	P38247 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4XPM_1 Protein MEH1 (chains A)
SPDSAKISKEQLKKLHSNILNEIFSQSQVNKPGPLTVPF

Sequence of entity 2 (B), FASTA

>4XPM_2 Uncharacterized protein YCR075W-A (chains B)
SMEAEKQSDIKGTIAFDTHGNVIESTGVGSQRIEDIGDLSKVTLDAEGFAQVQGDSLLVH
LYKRNDITLAVYTSAQ

Sequence of entity 3 (C), FASTA

>4XPM_3 Protein SLM4 (chains C)
MVMLHSKNVKGFLENTLKPYDLHSVDFKTSSLQSSMIITATNGGILSYATSNNDVPKNSI
NEINSVNNLKMMSLLIKDKWSEDENDTEEQHSNSCYPVEIDSFKTKIYTYEMEDLHTCVA
QIPNSDLLLLFIAEGSFPYGLLVIKIERAMRELTDLFGYKLG

Primary citation

Crystal structure of the Ego1-Ego2-Ego3 complex and its role in promoting Rag GTPase-dependent TORC1 signaling. Powis, K., Zhang, T., Panchaud, N. et al. Cell Res (2015) 25:1043-1059. DOI 10.1038/cr.2015.86 · PubMed

Other PDB entries of the same protein (UniProt Q02205 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9H4Q 3.1 Å, Cryo-EM structure of the SEAC wing - EGOC
6JWP 3.2 Å, crystal structure of EGOC
9H5K 3.2 Å, Cryo-EM structure of the SEAC-EGOC supercomplex

Browse structure collections

About this viewer

MolViewer shows 4XPM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.