4XST: Insulin receptor

Structure of the endoglycosidase-H treated L1-CR domains of the human insulin receptor in complex with residues 697-719 of the human insulin receptor (A-isoform). Determined by X-ray diffraction at 3.0 Å resolution. Released 10 Jun 2015.

Method: X-ray diffraction
Resolution: 3.0 Å
Organisms: Homo sapiens, Rattus norvegicus
Chains: 2
Atoms: 2,507
Mol. weight: 40.25 kDa
Ligands: NAG
Released: 10 Jun 2015

Explore 4XST in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4XST contains 11 α-helices and 29 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain E: 10 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	6-14	9	1
α-helix	18-23	6
β-strand	26-38	13	1
α-helix	43-47	5
β-strand	56-57	2	1
β-strand	61-66	6	1
β-strand	81-82	2	1
β-strand	88	1	1
β-strand	91-96	6	1
β-strand	111-112	2	1
β-strand	116-122	7	1
α-helix	133-135	3
β-strand	144-148	5	1
β-strand	172-174	3	2
β-strand	177-179	3	2
β-strand	182-184	3	3
β-strand	187-188	2	3
α-helix	189-190	2
α-helix	194-196	3
β-strand	201	1	4
α-helix	206	1
β-strand	207	1	4
α-helix	208-209	2
β-strand	212	1	5
β-strand	216	1	6
β-strand	225	1	6
β-strand	228	1	5
β-strand	231-233	3	7
β-strand	236-238	3	7
α-helix	241-242	2
β-strand	246-248	3	7
β-strand	252-254	3	7
α-helix	256-264	9
β-strand	278-280	3	7
β-strand	283-285	3	7
α-helix	288-289	2
β-strand	292-294	3	8
β-strand	300	1	7
β-strand	301-303	3	8

Chain F: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	699-708	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Insulin receptor	E	protein	317	Homo sapiens	P06213 (AlphaFold model)
Insulin receptor	F	protein	23	Rattus norvegicus	P15127 (AlphaFold model)

Sequence of entity 1 (E), FASTA

>4XST_1 Insulin receptor (chains E)
HLYPGEVCPGMDIRNNLTRLHELENCSVIEGHLQILLMFKTRPEDFRDLSFPKLIMITDY
LLLFRVYGLESLKDLFPNLTVIRGSRLFFNYALVIFEMVHLKELGLYNLMNITRGSVRIE
KNNELCYLATIDWSRILDSVEDNHIVLNKDDNEECGDICPGTAKGKTNCPATVINGQFVE
RCWTHSHCQKVCPTICKSHGCTAEGLCCHSECLGNCSQPDDPTKCVACRNFYLDGRCVET
CPPPYYHFQDWRCVNFSFCQDLHHKCKNSRRQGCHQYVIHNNKCIPECPSGYTMNSSNLL
CTPCLGPCPKSSSLVPR

Sequence of entity 2 (F), FASTA

>4XST_2 Insulin receptor (chains F)
ESSFRKTFEDYLHNVVFVPRKTS

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	3

Water and common crystallization additives (SO4) are not listed.

Primary citation

Structural Congruency of Ligand Binding to the Insulin and Insulin/Type 1 Insulin-like Growth Factor Hybrid Receptors. Menting, J.G., Lawrence, C.F., Kong, G.K. et al. Structure (2015) 23:1271-1282. DOI 10.1016/j.str.2015.04.016 · PubMed

Other PDB entries of the same protein (UniProt P06213 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3BU3 1.65 Å, Crystal structure of the insulin receptor kinase in complex with IRS2 KRLB peptide
5HHW 1.79 Å, Crystal structure of insulin receptor kinase domain in complex with…
4IBM 1.8 Å, Crystal structure of insulin receptor kinase domain in complex with an inhibitor Irfin-1
5U1M 1.8 Å, Structure of the IRS-1 PTB Domain Bound to the Juxtamembrane Region of the Insulin…
1IR3 1.9 Å, Phosphorylated insulin receptor tyrosine kinase in complex with peptide substrate and…
1P14 1.9 Å, Crystal structure of a catalytic-loop mutant of the insulin receptor tyrosine kinase
3BU6 1.95 Å, Crystal structure of the insulin receptor kinase in complex with IRS2 KRLB phosphopeptide
1IRK 2.1 Å, Crystal structure of the tyrosine kinase domain of the human insulin receptor
3BU5 2.1 Å, Crystal structure of the insulin receptor kinase in complex with IRS2 KRLB peptide and ATP
3EKK 2.1 Å, Insulin receptor kinase complexed with an inhibitor
8DWN 2.15 Å, Crystal structure of bis-phosphorylated insulin receptor kinase domain
3EKN 2.2 Å, Insulin receptor kinase complexed with an inhibitor

Browse structure collections

About this viewer

MolViewer shows 4XST directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.